RAB8A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB8A_MOUSE
• UniProt AC: P55258
• Protein Name: Ras-related protein Rab-8A
• Gene Name: Rab8a
• Organism: Mus musculus (Mouse).
• Sequence Length: 207
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Golgi apparatus . Recycling endosome membrane . Cell projection, cilium . Cytoplasmic vesicle, phagosome membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasm, cytoskeleton, microtubule organizing center,
• Protein Description: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in polarized vesicular trafficking and neurotransmitter release. Together with RAB11A, RAB3IP, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B and RAB11A participates in epithelial cell polarization. Plays an important role in ciliogenesis (By similarity). Together with MICALL2, may also regulate adherens junction assembly. [PubMed: 18094055 May play a role in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore play a role in glucose homeostasis (By similarity Involved in autophagy (By similarity]
• Protein Sequence: MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MAKTYDYLFKL ----CCCCHHHHHHH	16.46	22418434
5	Phosphorylation	---MAKTYDYLFKLL ---CCCCHHHHHHHH	11.24	29472430
7	Phosphorylation	-MAKTYDYLFKLLLI -CCCCHHHHHHHHHH	12.01	22418434
17	Phosphorylation	KLLLIGDSGVGKTCV HHHHHCCCCCCCEEE	30.11	22817900
58	Malonylation	ELDGKRIKLQIWDTA EECCEEEEEEEECCC	38.07	26073543
72	Phosphorylation	AGQERFRTITTAYYR CCHHHHHHHHHHHHH	21.69	19144319
74	Phosphorylation	QERFRTITTAYYRGA HHHHHHHHHHHHHCC	12.54	21183079
77	Phosphorylation	FRTITTAYYRGAMGI HHHHHHHHHHCCCEE	7.51	29514104
111	Phosphorylation	RNIEEHASADVEKMI HCHHHHCCCCHHHHH	27.23	21659605
116	Ubiquitination	HASADVEKMILGNKC HCCCCHHHHHHCCCC	30.96	-
122	Acetylation	EKMILGNKCDVNDKR HHHHHCCCCCCCCCC	29.98	15611697
128	Acetylation	NKCDVNDKRQVSKER CCCCCCCCCHHHHHH	39.25	15611707
133	Acetylation	NDKRQVSKERGEKLA CCCCHHHHHHHHHHH	53.20	15611717
138	Ubiquitination	VSKERGEKLALDYGI HHHHHHHHHHHHHHH	41.71	-
153	Ubiquitination	KFMETSAKANINVEN HEEECCCCCCCCHHH	41.56	-
164	Phosphorylation	NVENAFFTLARDIKA CHHHHHHHHHHHHHH	17.04	26824392
181	Phosphorylation	DKKLEGNSPQGSSHG HHHCCCCCCCCCCCC	29.47	25521595
185	Phosphorylation	EGNSPQGSSHGVKIT CCCCCCCCCCCEEEE	17.57	25521595
186	Phosphorylation	GNSPQGSSHGVKITV CCCCCCCCCCEEEEE	30.96	25521595
197	Malonylation	KITVEQQKRTSFFRC EEEEEECCCCCEEEE	58.29	26320211
204	Methylation	KRTSFFRCSLL---- CCCCEEEEECC----	2.58	-
204	Geranylgeranylation	KRTSFFRCSLL---- CCCCEEEEECC----	2.58	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
72	T	Phosphorylation	Kinase	LRRK2	Q5S007	PSP
72	T	Phosphorylation	Kinase	LRRK2	Q5S006	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
72	T	Phosphorylation	Phosphorylation of Thr-72 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitors GDI1 and GDI2.	26824392

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB8A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SYTL4_HUMAN	SYTL4	physical	20360068
MILK2_HUMAN	MICALL2	physical	20360068
RAB8A_HUMAN	RAB8A	physical	20360068
SYUA_HUMAN	SNCA	physical	15099020

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.