RAB4A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB4A_MOUSE
• UniProt AC: P56371
• Protein Name: Ras-related protein Rab-4A
• Gene Name: Rab4a
• Organism: Mus musculus (Mouse).
• Sequence Length: 218
• Subcellular Localization: Membrane ; Peripheral membrane protein . Cytoplasm . Early endosome membrane ; Peripheral membrane protein . Recycling endosome membrane ; Peripheral membrane protein . Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1.
• Protein Description: Protein transport. Probably involved in vesicular traffic (By similarity)..
• Protein Sequence: MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Serotonylation	QIWDTAGQERFRSVT EEEECCCHHHHHHHH	25.73	14697203
81	Phosphorylation	RFRSVTRSYYRGAAG HHHHHHHHHHCCCCC	8.17	17203969
82	Phosphorylation	FRSVTRSYYRGAAGA HHHHHHHHHCCCCCE	13.45	17203969
83	Phosphorylation	RSVTRSYYRGAAGAL HHHHHHHHCCCCCEE	19.07	17203969
190	Phosphorylation	LDPERMGSGIQYGDA CCHHHCCCCCCHHHH	11.16	-
204	Phosphorylation	AALRQLRSPRRTQAP HHHHHHCCCCCCCCC	49.84	29899451
216	Geranylgeranylation	QAPSAQECGC----- CCCCHHHCCC-----		-
218	Methylation	PSAQECGC------- CCHHHCCC-------		-
218	Geranylgeranylation	PSAQECGC------- CCHHHCCC-------		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
204	S	Phosphorylation	Kinase	CDK1	P11440	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB4A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB4A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB4A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.