UniProt ID | RAB4A_MOUSE | |
---|---|---|
UniProt AC | P56371 | |
Protein Name | Ras-related protein Rab-4A | |
Gene Name | Rab4a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 218 | |
Subcellular Localization |
Membrane Peripheral membrane protein . Cytoplasm . Early endosome membrane Peripheral membrane protein . Recycling endosome membrane Peripheral membrane protein . Generally associated with membranes. Cytoplasmic when phosphorylated by CDK1. |
|
Protein Description | Protein transport. Probably involved in vesicular traffic (By similarity).. | |
Protein Sequence | MAQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVLILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFMQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRTQAPSAQECGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
72 | Serotonylation | QIWDTAGQERFRSVT EEEECCCHHHHHHHH | 25.73 | 14697203 | |
81 | Phosphorylation | RFRSVTRSYYRGAAG HHHHHHHHHHCCCCC | 8.17 | 17203969 | |
82 | Phosphorylation | FRSVTRSYYRGAAGA HHHHHHHHHCCCCCE | 13.45 | 17203969 | |
83 | Phosphorylation | RSVTRSYYRGAAGAL HHHHHHHHCCCCCEE | 19.07 | 17203969 | |
190 | Phosphorylation | LDPERMGSGIQYGDA CCHHHCCCCCCHHHH | 11.16 | - | |
204 | Phosphorylation | AALRQLRSPRRTQAP HHHHHHCCCCCCCCC | 49.84 | 29899451 | |
216 | Geranylgeranylation | QAPSAQECGC----- CCCCHHHCCC----- | - | ||
218 | Methylation | PSAQECGC------- CCHHHCCC------- | - | ||
218 | Geranylgeranylation | PSAQECGC------- CCHHHCCC------- | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
204 | S | Phosphorylation | Kinase | CDK1 | P11440 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB4A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB4A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAB4A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...