RAB3D_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB3D_MOUSE
• UniProt AC: P35276
• Protein Name: Ras-related protein Rab-3D
• Gene Name: Rab3d
• Organism: Mus musculus (Mouse).
• Sequence Length: 219
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Protein transport. Probably involved in vesicular traffic (By similarity). May be involved in the insulin-induced exocytosis of glut4-containing vesicles in adipocytes..
• Protein Sequence: MASASEPPASPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFTAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDIICDKMNESLEPSSSPGSNGKGPALGDTPPPQPSSCSC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASASEPPA ------CCCCCCCCC	17.50	-
3	Phosphorylation	-----MASASEPPAS -----CCCCCCCCCC	30.91	30635358
5	Phosphorylation	---MASASEPPASPR ---CCCCCCCCCCHH	48.41	30635358
10	Phosphorylation	SASEPPASPRDAADQ CCCCCCCCHHCCHHC	26.66	26643407
21	Phosphorylation	AADQNFDYMFKLLLI CHHCCHHHHEEEEEE	10.58	24759943
31	Phosphorylation	KLLLIGNSSVGKTSF EEEEECCCCCCCEEE	22.61	22324799
32	Phosphorylation	LLLIGNSSVGKTSFL EEEECCCCCCCEEEE	38.60	22324799
37	Phosphorylation	NSSVGKTSFLFRYAD CCCCCCEEEEEEECC	24.36	22817900
42	Phosphorylation	KTSFLFRYADDSFTP CEEEEEEECCCCCCC	13.67	29899451
86	Phosphorylation	AGQERYRTITTAYYR CCHHHHHHHHHHHHH	17.46	29125462
91	Phosphorylation	YRTITTAYYRGAMGF HHHHHHHHHHHHHHH	7.51	29514104
190	Phosphorylation	ICDKMNESLEPSSSP HHHHCCCCCCCCCCC	32.78	-
199	Phosphorylation	EPSSSPGSNGKGPAL CCCCCCCCCCCCCCC	45.88	25521595
217	Geranylgeranylation	PPPQPSSCSC----- CCCCCCCCCC-----	5.89	-
219	Geranylgeranylation	PQPSSCSC------- CCCCCCCC-------	8.30	-
219	Methylation	PQPSSCSC------- CCCCCCCC-------	8.30	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
86	T	Phosphorylation	Kinase	LRRK2	Q5S006	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
86	T	Phosphorylation	Phosphorylation of Thr-86 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM and CHML.	29125462

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB3D_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB3D_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.