RAB3C_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB3C_MOUSE
• UniProt AC: P62823
• Protein Name: Ras-related protein Rab-3C
• Gene Name: Rab3c
• Organism: Mus musculus (Mouse).
• Sequence Length: 227
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Protein transport. Probably involved in vesicular traffic (By similarity)..
• Protein Sequence: MRHEAPMQMASAQDARFGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILAGNKCDMEDERVVSTERGQRLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQSTRLKETPPPPQPNCGC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	EAPMQMASAQDARFG CCCCCHHHHHHHCCC	22.56	27742792
20	Ubiquitination	QDARFGQKDSSDQNF HHHCCCCCCCCCCCH	61.02	22790023
22	Phosphorylation	ARFGQKDSSDQNFDY HCCCCCCCCCCCHHH	42.73	29899451
39	Phosphorylation	KLLIIGNSSVGKTSF EEEEECCCCCCCEEE	22.61	22817900
40	Phosphorylation	LLIIGNSSVGKTSFL EEEECCCCCCCEEEE	38.60	22817900
45	Phosphorylation	NSSVGKTSFLFRYAD CCCCCCEEEEEEECC	24.36	15648052
86	Phosphorylation	IKLQIWDTAGQERYR EEEEEEECCCHHHHH	20.07	29125462
94	Phosphorylation	AGQERYRTITTAYYR CCHHHHHHHHHHHHH	17.46	29514104
99	Phosphorylation	YRTITTAYYRGAMGF HHHHHHHHHHCCCEE	7.51	29514104
181	Ubiquitination	AKDNINVKQTFERLV CCCCCCHHHHHHHHH	38.85	22790023
196	Phosphorylation	DIICDKMSESLETDP HHHHHHCCHHCCCCH	29.76	28066266
198	Phosphorylation	ICDKMSESLETDPAI HHHHCCHHCCCCHHH	24.97	25521595
201	Phosphorylation	KMSESLETDPAITAA HCCHHCCCCHHHHHH	53.21	20415495
206	Phosphorylation	LETDPAITAAKQSTR CCCCHHHHHHHHHCC	23.75	19060867
209	Ubiquitination	DPAITAAKQSTRLKE CHHHHHHHHHCCCCC	42.17	22790023
211	Phosphorylation	AITAAKQSTRLKETP HHHHHHHHCCCCCCC	18.13	25521595
212	Phosphorylation	ITAAKQSTRLKETPP HHHHHHHCCCCCCCC	37.21	20415495
225	Geranylgeranylation	PPPPQPNCGC----- CCCCCCCCCC-----	8.19	-
227	Methylation	PPQPNCGC------- CCCCCCCC-------	5.70	-
227	Geranylgeranylation	PPQPNCGC------- CCCCCCCC-------	5.70	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
86	T	Phosphorylation	Kinase	LRRK2	Q5S006	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
86	T	Phosphorylation	Phosphorylation of Thr-86 in the switch II region by LRRK2 prevents the association of RAB regulatory proteins, including CHM, CHML and RAB GDP dissociation inhibitor GDI2.	29125462

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB3C_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB3C_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.