| UniProt ID | RAB3A_RAT | |
|---|---|---|
| UniProt AC | P63012 | |
| Protein Name | Ras-related protein Rab-3A | |
| Gene Name | Rab3a | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 220 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal (By similarity).. | |
| Protein Sequence | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MASATDSRYGQKES -CCCCCCCCCCCCCC | 24.05 | 23984901 | |
| 14 | Phosphorylation | SRYGQKESSDQNFDY CCCCCCCCCCCCCCE | 46.37 | 28432305 | |
| 15 | Phosphorylation | RYGQKESSDQNFDYM CCCCCCCCCCCCCEE | 44.28 | 28432305 | |
| 72 | Acetylation | YRNDKRIKLQIWDTA EECCCEEEEEEECCC | 38.07 | 14656801 | |
| 72 | Ubiquitination | YRNDKRIKLQIWDTA EECCCEEEEEEECCC | 38.07 | - | |
| 86 | Phosphorylation | AGQERYRTITTAYYR CCHHHHHHHHHHHHH | 17.46 | - | |
| 173 | Acetylation | AKDNINVKQTFERLV HCCCCCHHHHHHHHH | 38.85 | 14507323 | |
| 173 | Ubiquitination | AKDNINVKQTFERLV HCCCCCHHHHHHHHH | 38.85 | - | |
| 188 | Phosphorylation | DVICEKMSESLDTAD HHHHHHHHHCCCCCC | 34.79 | 25403869 | |
| 190 | Phosphorylation | ICEKMSESLDTADPA HHHHHHHCCCCCCCC | 25.00 | 30240740 | |
| 218 | Geranylgeranylation | QAPPHQDCAC----- CCCCCCCCCC----- | 3.15 | - | |
| 220 | Methylation | PPHQDCAC------- CCCCCCCC------- | 7.82 | - | |
| 220 | Geranylgeranylation | PPHQDCAC------- CCCCCCCC------- | 7.82 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB3A_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 86 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB3A_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAB3A_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...