UniProt ID | RAB3A_RAT | |
---|---|---|
UniProt AC | P63012 | |
Protein Name | Ras-related protein Rab-3A | |
Gene Name | Rab3a | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 220 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Involved in exocytosis by regulating a late step in synaptic vesicle fusion. Could play a role in neurotransmitter release by regulating membrane flow in the nerve terminal (By similarity).. | |
Protein Sequence | MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLTDQQAPPHQDCAC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MASATDSRYGQKES -CCCCCCCCCCCCCC | 24.05 | 23984901 | |
14 | Phosphorylation | SRYGQKESSDQNFDY CCCCCCCCCCCCCCE | 46.37 | 28432305 | |
15 | Phosphorylation | RYGQKESSDQNFDYM CCCCCCCCCCCCCEE | 44.28 | 28432305 | |
72 | Acetylation | YRNDKRIKLQIWDTA EECCCEEEEEEECCC | 38.07 | 14656801 | |
72 | Ubiquitination | YRNDKRIKLQIWDTA EECCCEEEEEEECCC | 38.07 | - | |
86 | Phosphorylation | AGQERYRTITTAYYR CCHHHHHHHHHHHHH | 17.46 | - | |
173 | Acetylation | AKDNINVKQTFERLV HCCCCCHHHHHHHHH | 38.85 | 14507323 | |
173 | Ubiquitination | AKDNINVKQTFERLV HCCCCCHHHHHHHHH | 38.85 | - | |
188 | Phosphorylation | DVICEKMSESLDTAD HHHHHHHHHCCCCCC | 34.79 | 25403869 | |
190 | Phosphorylation | ICEKMSESLDTADPA HHHHHHHCCCCCCCC | 25.00 | 30240740 | |
218 | Geranylgeranylation | QAPPHQDCAC----- CCCCCCCCCC----- | 3.15 | - | |
220 | Methylation | PPHQDCAC------- CCCCCCCC------- | 7.82 | - | |
220 | Geranylgeranylation | PPHQDCAC------- CCCCCCCC------- | 7.82 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB3A_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
86 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB3A_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAB3A_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...