RAB34_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB34_MOUSE
• UniProt AC: Q64008
• Protein Name: Ras-related protein Rab-34
• Gene Name: Rab34
• Organism: Mus musculus (Mouse).
• Sequence Length: 259
• Subcellular Localization: Cytoplasm . Golgi apparatus . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane ; Lipid-anchor ; Cytoplasmic side . Cell projection, cilium . Recruited to phagosomes containing S.aureus or Mycobacterium.
• Protein Description: Protein transport. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium. Plays a role in the fusion of phagosomes with lysosomes (By similarity). Involved in the redistribution of lysosomes to the peri-Golgi region. [PubMed: 12475955 Acts also as a positive regulator of hedgehog signaling and regulates ciliary function]
• Protein Sequence: MNILAPVRRDRVLAELPQCLKKEAALHVRKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGVPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLTDALKENDPSNVLLFLVGSKKDLSTPAQYSLMEKDALKVAQEIKAEYWAVSSLTGENVREFFFRVAALTFEANVLADVEKSGARHIADVVRINSDDKNLYLTASKKKATCCP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNILAPVR -------CCCCCCCC	6.76	-
76	Phosphorylation	INRFCKDTFDKNYKA HCHHCHHCCCCCCCE	21.16	26824392
81	Phosphorylation	KDTFDKNYKATIGVD HHCCCCCCCEEEEEE	14.03	29514104
241	Phosphorylation	ADVVRINSDDKNLYL EEEEEECCCCCCEEE	44.83	12475955
247	Phosphorylation	NSDDKNLYLTASKKK CCCCCCEEEEEECCC	16.05	29514104
257	Geranylgeranylation	ASKKKATCCP----- EECCCCCCCC-----	3.77	-
258	Geranylgeranylation	SKKKATCCP------ ECCCCCCCC------	3.78	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB34_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB34_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB34_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB34_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-241, AND MASSSPECTROMETRY.
PubMed: 19144319