RAB32_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB32_MOUSE
• UniProt AC: Q9CZE3
• Protein Name: Ras-related protein Rab-32
• Gene Name: Rab32
• Organism: Mus musculus (Mouse).
• Sequence Length: 223
• Subcellular Localization: Mitochondrion . Mitochondrion outer membrane ; Lipid-anchor . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane ; Lipid-anchor ; Cytoplasmic side . Melanosome . Melanosome membrane . Recruited to phagosomes containing S.aureus
• Protein Description: Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium (By similarity). Plays an important role in the control of melanin production and melanosome biogenesis (By similarity). In concert with RAB38, regulates the proper trafficking of melanogenic enzymes TYR, TYRP1 and DCT/TYRP2 to melanosomes in melanocytes. [PubMed: 26620560]
• Protein Sequence: MAGEGLGQQGASATAAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEALGAFVVFDISRSSTFDAVLKWKNDLDSKVHLPNGSPIPAVLLANKCDQKKDNSQSPSQMDQFCKDHGFTGWFETSAKDNINIDEATRFLVENMLANQQSFPSEEIDLDRIKLVEEPPTTKPRSQCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGEGLGQQ ------CCCCCCCCC	25.41	-
12	Phosphorylation	GLGQQGASATAAPET CCCCCCCCCCCCHHH	32.74	30635358
14	Phosphorylation	GQQGASATAAPETRE CCCCCCCCCCHHHHH	22.36	30635358
19	Phosphorylation	SATAAPETREHLFKV CCCCCHHHHHHHHHH	40.05	30635358
52	Phosphorylation	HQLFSQHYRATIGVD HHHHHHHHHHHCCCC	8.36	29514104
69	Phosphorylation	LKVLNWDSRTLVRLQ EEECCCCCCCEEEEE	20.84	29472430
132	Phosphorylation	KVHLPNGSPIPAVLL CEECCCCCCCCHHHH	26.71	25338131
199	Phosphorylation	ANQQSFPSEEIDLDR HCCCCCCCCCCCHHH	45.94	19367708
222	Geranylgeranylation	TTKPRSQCC------ CCCCCHHCC------	2.91	-
223	Geranylgeranylation	TKPRSQCC------- CCCCHHCC-------	4.91	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB32_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB32_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB32_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB32_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.