RAB31_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB31_MOUSE
• UniProt AC: Q921E2
• Protein Name: Ras-related protein Rab-31
• Gene Name: Rab31
• Organism: Mus musculus (Mouse).
• Sequence Length: 194
• Subcellular Localization: Early endosome . Golgi apparatus, trans-Golgi network . Golgi apparatus, trans-Golgi network membrane ; Lipid-anchor ; Cytoplasmic side . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane ; Lipid-anchor ; Cytoplasmic side . Rap
• Protein Description: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Required for the integrity and for normal function of the Golgi apparatus and the trans-Golgi network. Plays a role in insulin-stimulated translocation of GLUT4 to the cell membrane. Plays a role in the maturation of phagosomes that engulf pathogens, such as S.aureus and Mycobacterium (By similarity). Plays a role in M6PR transport from the trans-Golgi network to endosomes. Plays a role in the internalization of EGFR from the cell membrane into endosomes..
• Protein Sequence: MAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQENGNSGGIKLGNQSLQASRRCC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
35	Phosphorylation	DHFDHNISPTIGASF HHCCCCCCCCCCCCE	22.70	25521595
37	Phosphorylation	FDHNISPTIGASFMT CCCCCCCCCCCCEEC	25.83	25521595
41	Phosphorylation	ISPTIGASFMTKTVP CCCCCCCCEECCCCC	15.44	25159016
44	Phosphorylation	TIGASFMTKTVPCGN CCCCCEECCCCCCCC	22.89	25159016
49	Glutathionylation	FMTKTVPCGNELHKF EECCCCCCCCEEEEE	8.75	24333276
136	Phosphorylation	PLKDAKEYAESIGAI CHHHHHHHHHHHCEE	18.24	28059163
186	Phosphorylation	GIKLGNQSLQASRRC CEECCHHHHHHHHCC	26.84	28066266
190	Phosphorylation	GNQSLQASRRCC--- CHHHHHHHHCCC---	13.80	28066266
193	Geranylgeranylation	SLQASRRCC------ HHHHHHCCC------	2.91	-
194	Geranylgeranylation	LQASRRCC------- HHHHHCCC-------	6.23	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB31_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB31_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB31_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB31_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"The phagosomal proteome in interferon-gamma-activated macrophages.";
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,Thibault P.;
Immunity 30:143-154(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-35, AND MASSSPECTROMETRY.
PubMed: 19144319