UniProt ID | RAB20_HUMAN | |
---|---|---|
UniProt AC | Q9NX57 | |
Protein Name | Ras-related protein Rab-20 | |
Gene Name | RAB20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization |
Golgi apparatus . Cytoplasmic vesicle, phagosome . Cytoplasmic vesicle, phagosome membrane Lipid-anchor Cytoplasmic side . Highly enriched on apical endocytic structures in polarized epithelial cells of kidney proximal tubules (By similarity). Re |
|
Protein Description | Plays a role in apical endocytosis/recycling. Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in the fusion of phagosomes with lysosomes.. | |
Protein Sequence | MRKPDSKIVLLGDMNVGKTSLLQRYMERRFPDTVSTVGGAFYLKQWRSYNISIWDTAGREQFHGLGSMYCRGAAAIILTYDVNHRQSLVELEDRFLGLTDTASKDCLFAIVGNKVDLTEEGALAGQEKEECSPNMDAGDRVSPRAPKQVQLEDAVALYKKILKYKMLDEQDVPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMILQQRAERPSHTVDISSHKPPKRTRSGCCA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | KTSLLQRYMERRFPD HHHHHHHHHHHHCCC | 7.14 | - | |
132 | Phosphorylation | GQEKEECSPNMDAGD CCCCCCCCCCCCCCC | 23.69 | 25159151 | |
142 | Phosphorylation | MDAGDRVSPRAPKQV CCCCCCCCCCCCCCC | 15.01 | 28985074 | |
147 | Ubiquitination | RVSPRAPKQVQLEDA CCCCCCCCCCCHHHH | 63.22 | 29967540 | |
159 | Ubiquitination | EDAVALYKKILKYKM HHHHHHHHHHHHHCC | 33.90 | 29967540 | |
214 | Phosphorylation | QQRAERPSHTVDISS HHHHCCCCCCCCCCC | 37.70 | 26471730 | |
216 | Phosphorylation | RAERPSHTVDISSHK HHCCCCCCCCCCCCC | 24.98 | 26471730 | |
220 | Phosphorylation | PSHTVDISSHKPPKR CCCCCCCCCCCCCCC | 23.17 | 28555341 | |
221 | Phosphorylation | SHTVDISSHKPPKRT CCCCCCCCCCCCCCC | 35.54 | 26471730 | |
232 | Geranylgeranylation | PKRTRSGCCA----- CCCCCCCCCC----- | 1.55 | - | |
233 | Geranylgeranylation | KRTRSGCCA------ CCCCCCCCC------ | 6.01 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB20_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB20_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB20_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAB20_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...