RAB1C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAB1C_ARATH
• UniProt AC: P92963
• Protein Name: Ras-related protein RABB1c
• Gene Name: RABB1C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 211
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Intracellular vesicle trafficking and protein transport..
• Protein Sequence: MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNESYGIKVGYGGIPGPSGGRDGSTSQGGGCCG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSYAYLFKY ------CCCEEEEEE	20.62	22223895
67	Phosphorylation	WDTAGQESFRSITRS EECCCHHHHHHHHHH	20.33	30291188
209	Geranylgeranylation	STSQGGGCCG----- CCCCCCCCCC-----	2.45	-
210	Geranylgeranylation	TSQGGGCCG------ CCCCCCCCC------	9.07	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAB1C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAB1C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAB1C_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RAB1C_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.