UniProt ID | RAB1C_ARATH | |
---|---|---|
UniProt AC | P92963 | |
Protein Name | Ras-related protein RABB1c | |
Gene Name | RABB1C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 211 | |
Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
Protein Description | Intracellular vesicle trafficking and protein transport.. | |
Protein Sequence | MSYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAHRRAVSTEEGEQFAKEHGLIFMEASAKTAQNVEEAFIKTAATIYKKIQDGVFDVSNESYGIKVGYGGIPGPSGGRDGSTSQGGGCCG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSYAYLFKY ------CCCEEEEEE | 20.62 | 22223895 | |
67 | Phosphorylation | WDTAGQESFRSITRS EECCCHHHHHHHHHH | 20.33 | 30291188 | |
209 | Geranylgeranylation | STSQGGGCCG----- CCCCCCCCCC----- | 2.45 | - | |
210 | Geranylgeranylation | TSQGGGCCG------ CCCCCCCCC------ | 9.07 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB1C_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB1C_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB1C_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RAB1C_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...