| UniProt ID | RAB1B_MOUSE | |
|---|---|---|
| UniProt AC | Q9D1G1 | |
| Protein Name | Ras-related protein Rab-1B | |
| Gene Name | Rab1b | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 201 | |
| Subcellular Localization |
Cytoplasm . Membrane Lipid-anchor Cytoplasmic side . Preautophagosomal structure membrane Lipid-anchor Cytoplasmic side . Targeted by REP1 to membranes of specific subcellular compartments including endoplasmic reticulum, Golgi apparatus, and |
|
| Protein Description | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1B regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum.. | |
| Protein Sequence | MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MNPEYDYL -------CCHHHHHH | 19.94 | - | |
| 5 | Phosphorylation | ---MNPEYDYLFKLL ---CCHHHHHHHHHH | 15.90 | 22499769 | |
| 7 | Phosphorylation | -MNPEYDYLFKLLLI -CCHHHHHHHHHHHH | 17.09 | 22499769 | |
| 17 | Phosphorylation | KLLLIGDSGVGKSCL HHHHHCCCCCCCCCE | 30.11 | 22817900 | |
| 36 | Phosphorylation | ADDTYTESYISTIGV CCCCCCHHHHHHEEC | 21.70 | 25159016 | |
| 37 | Phosphorylation | DDTYTESYISTIGVD CCCCCHHHHHHEECC | 7.83 | 25159016 | |
| 39 | Phosphorylation | TYTESYISTIGVDFK CCCHHHHHHEECCEE | 13.02 | 25159016 | |
| 55 | Ubiquitination | RTIELDGKTIKLQIW EEEEECCEEEEEEEE | 46.90 | - | |
| 58 | Ubiquitination | ELDGKTIKLQIWDTA EECCEEEEEEEECCC | 39.30 | - | |
| 72 | Phosphorylation | AGQERFRTITSSYYR CCHHHHHHHHHHHHC | 26.37 | 26239621 | |
| 74 | Phosphorylation | QERFRTITSSYYRGA HHHHHHHHHHHHCCC | 15.82 | 26745281 | |
| 75 | Phosphorylation | ERFRTITSSYYRGAH HHHHHHHHHHHCCCC | 16.70 | 24453211 | |
| 76 | Other | RFRTITSSYYRGAHG HHHHHHHHHHCCCCE | 19.96 | - | |
| 76 | Phosphorylation | RFRTITSSYYRGAHG HHHHHHHHHHCCCCE | 19.96 | 26745281 | |
| 76 | O-(2-cholinephosphoryl)serine | RFRTITSSYYRGAHG HHHHHHHHHHCCCCE | 19.96 | - | |
| 77 | Phosphorylation | FRTITSSYYRGAHGI HHHHHHHHHCCCCEE | 9.28 | 29472430 | |
| 109 | Phosphorylation | WLQEIDRYASENVNK HHHHHHHHHCCCHHH | 15.67 | 22499769 | |
| 111 | Phosphorylation | QEIDRYASENVNKLL HHHHHHHCCCHHHHH | 22.29 | 22499769 | |
| 116 | Ubiquitination | YASENVNKLLVGNKS HHCCCHHHHHCCCHH | 38.63 | - | |
| 137 | Acetylation | VVDNTTAKEFADSLG ECCCCCHHHHHHHHC | 51.80 | 23954790 | |
| 164 | Phosphorylation | NVEQAFMTMAAEIKK CHHHHHHHHHHHHHH | 9.37 | 29514104 | |
| 179 | Phosphorylation | RMGPGAASGGERPNL HHCCCCCCCCCCCCC | 46.96 | 24899341 | |
| 200 | Geranylgeranylation | VKPASGGCC------ CCCCCCCCC------ | 2.58 | - | |
| 201 | Methylation | KPASGGCC------- CCCCCCCC------- | 7.65 | - | |
| 201 | Geranylgeranylation | KPASGGCC------- CCCCCCCC------- | 7.65 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB1B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB1B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB1B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAB1B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...