| UniProt ID | RAB18_MOUSE | |
|---|---|---|
| UniProt AC | P35293 | |
| Protein Name | Ras-related protein Rab-18 | |
| Gene Name | Rab18 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 206 | |
| Subcellular Localization |
Apical cell membrane Lipid-anchor . Basal cell membrane Lipid-anchor . Highly enriched on apical endocytic structures in polarized epithelial cells of kidney proximal tubules. Detected on both the apical and basolateral domains in epithelial cell |
|
| Protein Description | Plays a role in apical endocytosis/recycling. May be implicated in transport between the plasma membrane and early endosomes. Plays a key role in eye and brain development and neurodegeneration (By similarity).. | |
| Protein Sequence | MDEDVLTTLKILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYCSVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDEDVLTT -------CCHHHHHH | 13.21 | - | |
| 7 | Phosphorylation | -MDEDVLTTLKILII -CCHHHHHHEEEEEE | 29.90 | 28576409 | |
| 8 | Phosphorylation | MDEDVLTTLKILIIG CCHHHHHHEEEEEEC | 23.15 | 28576409 | |
| 46 | Methylation | ATIGVDFKVKTISVD HHHCCEEEEEEEEEC | 38.06 | - | |
| 49 | Phosphorylation | GVDFKVKTISVDGNK CCEEEEEEEEECCCE | 22.82 | 25338131 | |
| 72 | Phosphorylation | AGQERFRTLTPSYYR CCCHHHHHCCHHHHC | 32.07 | 29514104 | |
| 76 | Phosphorylation | RFRTLTPSYYRGAQG HHHHCCHHHHCCCCE | 29.57 | 29514104 | |
| 91 | Phosphorylation | VILVYDVTRRDTFVK EEEEEECCCCCCEEE | 19.65 | 19854140 | |
| 110 | Glutathionylation | LNELETYCTRNDIVN HHHHHHHHCHHHHHH | 3.63 | 24333276 | |
| 110 | S-palmitoylation | LNELETYCTRNDIVN HHHHHHHHCHHHHHH | 3.63 | 28526873 | |
| 123 | Ubiquitination | VNMLVGNKIDKENRE HHHHHCCCCCHHHCC | 46.48 | 22790023 | |
| 126 | Ubiquitination | LVGNKIDKENREVDR HHCCCCCHHHCCCCH | 61.43 | 22790023 | |
| 138 | Ubiquitination | VDRNEGLKFARKHSM CCHHHHHHHHHHCCE | 48.08 | - | |
| 138 | Acetylation | VDRNEGLKFARKHSM CCHHHHHHHHHHCCE | 48.08 | 23864654 | |
| 138 | Malonylation | VDRNEGLKFARKHSM CCHHHHHHHHHHCCE | 48.08 | 26320211 | |
| 144 | Phosphorylation | LKFARKHSMLFIEAS HHHHHHCCEEEEEEC | 21.88 | 25521595 | |
| 183 | Ubiquitination | WESENQNKGVKLSHR CCCCCCCCCCCCCCC | 56.15 | 22790023 | |
| 188 | Phosphorylation | QNKGVKLSHREESRG CCCCCCCCCCCHHCC | 18.12 | 29176673 | |
| 199 | S-palmitoylation | ESRGGGACGGYCSVL HHCCCCCCCCCCCCC | 5.00 | - | |
| 203 | Methylation | GGACGGYCSVL---- CCCCCCCCCCC---- | 2.28 | - | |
| 203 | Geranylgeranylation | GGACGGYCSVL---- CCCCCCCCCCC---- | 2.28 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAB18_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAB18_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAB18_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of RAB18_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
