UniProt ID | RAA5C_ARATH | |
---|---|---|
UniProt AC | P28187 | |
Protein Name | Ras-related protein RABA5c | |
Gene Name | RABA5C | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 214 | |
Subcellular Localization |
Golgi apparatus membrane Lipid-anchor . Golgi apparatus, trans-Golgi network membrane Lipid-anchor . Cell membrane Lipid-anchor . |
|
Protein Description | Intracellular vesicle trafficking and protein transport. Binds GTP and GDP and possesses intrinsic GTPase activity.. | |
Protein Sequence | MSDDDERGEEYLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLESIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEELTVNRVSLVKNENEGTKTFSCCSR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDDDERGE ------CCCCCHHCC | 50.15 | 24924143 | |
184 | Phosphorylation | ISRKQLNSDSYKEEL CCHHHCCCCCCCEEE | 36.20 | 23776212 | |
186 | Phosphorylation | RKQLNSDSYKEELTV HHHCCCCCCCEEEEE | 37.61 | 30291188 | |
187 | Phosphorylation | KQLNSDSYKEELTVN HHCCCCCCCEEEEEE | 27.66 | 23776212 | |
192 | Phosphorylation | DSYKEELTVNRVSLV CCCCEEEEEEEEEEE | 21.00 | 23776212 | |
211 | Geranylgeranylation | EGTKTFSCCSR---- CCCEEEECCCC---- | 1.82 | - | |
212 | Geranylgeranylation | GTKTFSCCSR----- CCEEEECCCC----- | 3.57 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAA5C_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAA5C_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAA5C_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CRK10_ARATH | CRK10 | physical | 22737156 | |
AB10G_ARATH | AT1G53270 | physical | 22737156 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...