dbPTM

RAA5C_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAA5C_ARATH
UniProt AC	P28187
Protein Name	Ras-related protein RABA5c
Gene Name	RABA5C
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	214
Subcellular Localization	Golgi apparatus membrane Lipid-anchor . Golgi apparatus, trans-Golgi network membrane Lipid-anchor . Cell membrane Lipid-anchor .
Protein Description	Intracellular vesicle trafficking and protein transport. Binds GTP and GDP and possesses intrinsic GTPase activity..
Protein Sequence	MSDDDERGEEYLFKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLESIRAVSVEEGKSLAESEGLFFMETSALDSTNVKTAFEMVIREIYSNISRKQLNSDSYKEELTVNRVSLVKNENEGTKTFSCCSR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDDDERGE ------CCCCCHHCC	50.15	24924143
184	Phosphorylation	ISRKQLNSDSYKEEL CCHHHCCCCCCCEEE	36.20	23776212
186	Phosphorylation	RKQLNSDSYKEELTV HHHCCCCCCCEEEEE	37.61	30291188
187	Phosphorylation	KQLNSDSYKEELTVN HHCCCCCCCEEEEEE	27.66	23776212
192	Phosphorylation	DSYKEELTVNRVSLV CCCCEEEEEEEEEEE	21.00	23776212
211	Geranylgeranylation	EGTKTFSCCSR---- CCCEEEECCCC----	1.82	-
212	Geranylgeranylation	GTKTFSCCSR----- CCEEEECCCC-----	3.57	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAA5C_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAA5C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAA5C_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
CRK10_ARATH	CRK10	physical	22737156
AB10G_ARATH	AT1G53270	physical	22737156

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAA5C_ARATH

Related Literatures of Post-Translational Modification