dbPTM

RAA4B_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAA4B_ARATH
UniProt AC	Q9SMQ6
Protein Name	Ras-related protein RABA4b {ECO:0000303\|PubMed:12644670}
Gene Name	RABA4B {ECO:0000303\|PubMed:12644670}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	224
Subcellular Localization	Early endosome membrane . Golgi apparatus, trans-Golgi network membrane Lipid-anchor .
Protein Description	Regulator of membrane trafficking. May be required for secretion of cell wall components in cells..
Protein Sequence	MAGGGGYGGASGKVDYVFKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAGQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLEDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKKNLASEGDSNNPGSLAGKKILIPGSGQEIPAKTSTCCTSS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGGGGYGG ------CCCCCCCCC	25.90	22223895
189	Phosphorylation	VNKKNLASEGDSNNP HCHHCCCCCCCCCCC	45.32	25561503
193	Phosphorylation	NLASEGDSNNPGSLA CCCCCCCCCCCCCCC	49.73	25561503
198	Phosphorylation	GDSNNPGSLAGKKIL CCCCCCCCCCCCEEE	19.12	24894044
220	Geranylgeranylation	IPAKTSTCCTSS--- CCCCCCCCCCCC---	2.09	-
221	Geranylgeranylation	PAKTSTCCTSS---- CCCCCCCCCCC----	4.13	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAA4B_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAA4B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAA4B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
P4KB1_ARATH	PI-4KBETA1	physical	16567499

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAA4B_ARATH

Related Literatures of Post-Translational Modification