RAA2C_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAA2C_ARATH
• UniProt AC: Q96283
• Protein Name: Ras-related protein RABA2c
• Gene Name: RABA2C
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 217
• Subcellular Localization: Endosome membrane . Golgi apparatus, trans-Golgi network membrane ; Lipid-anchor . During cytokinesis located to the growing margins of the cell plate.
• Protein Description: Intracellular vesicle trafficking and protein transport..
• Protein Sequence: MTHRVDQEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDLNHLRSVAEEDGQSLAEKEGLSFLETSALEATNVEKAFQTILGEIYHIISKKALAAQEAAAANSAIPGQGTTINVDDTSGGAKRACCSS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	EFCLESKSTIGVEFA CCCCCCCCEEEEEEC	34.24	25561503
44	Phosphorylation	FCLESKSTIGVEFAT CCCCCCCEEEEEECE	26.03	19880383
214	Geranylgeranylation	SGGAKRACCSS---- CCCCCCHHCCC----	2.41	-
215	Geranylgeranylation	GGAKRACCSS----- CCCCCHHCCC-----	4.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAA2C_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAA2C_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAA2C_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RAA2C_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.