R23A1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: R23A1_ARATH
• UniProt AC: Q8LD46
• Protein Name: 60S ribosomal protein L23a-1
• Gene Name: RPL23AA
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 154
• Protein Description: Binds to a specific region on the 26S rRNA..
• Protein Sequence: MSPAKVDTTKKADPKAKALKAAKAVKSGQAFKKKDKKIRTKVTFHRPKTLTKPRTGKYPKISATPRNKLDHYQILKYPLTTESAMKKIEDNNTLVFIVDIRADKKKIKDAVKKMYDIQTKKVNTLIRPDGTKKAYVRLTPDYDALDVANKIGII

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
85	Sulfoxidation	PLTTESAMKKIEDNN CCCCHHHHHHHCCCC	6.73	25693801
139	Phosphorylation	KKAYVRLTPDYDALD CEEEEEECCCCCHHH	11.98	19880383
142	Phosphorylation	YVRLTPDYDALDVAN EEEECCCCCHHHHHH	12.34	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of R23A1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of R23A1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of R23A1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of R23A1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.