UniProt ID | R10A2_ARATH | |
---|---|---|
UniProt AC | P59230 | |
Protein Name | 60S ribosomal protein L10a-2 | |
Gene Name | RPL10AB | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 216 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSKLQSEAVREAITTIKGKSEEKKRNFVETVELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKICMLGDAQHVEEAEKMGLSNMDVEALKKLNKNKKLVKKLAKSYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSKLQSEAV ------CCHHHHHHH | 41.91 | 19880383 | |
90 | Methylation | NMDVEALKKLNKNKK CCCHHHHHHHHHCHH | 63.36 | 17934214 | |
90 | Acetylation | NMDVEALKKLNKNKK CCCHHHHHHHHHCHH | 63.36 | 21311030 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of R10A2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of R10A2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of R10A2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of R10A2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...