QSOX2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: QSOX2_MOUSE
• UniProt AC: Q3TMX7
• Protein Name: Sulfhydryl oxidase 2
• Gene Name: Qsox2
• Organism: Mus musculus (Mouse).
• Sequence Length: 692
• Subcellular Localization: Membrane; Single-pass membrane protein.
• Protein Description: Catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides with the reduction of oxygen to hydrogen peroxide. May contribute to disulfide bond formation in a variety of secreted proteins (By similarity)..
• Protein Sequence: MAAARAVARDPGAYARQPPSLRAARLPRLLFLLAVVAAVGPREGGGARLYREGSDAVWLLDSGSVRSATGNSSAAWLVQFHSSWCGHCIGYAPTWRALAADVRDWAAAIRVAALDCAEEKNQDVCRTYDIHFYPTFRYFKAFTKEFTTGENFKGPDRELRTVRQTMIDFLQNHTEGTWPPACPPLDPIQSSDILSFMDSHSGQYHAIVFESNGSYVGREVILDLIPYENIMVSRALDTDKAFLGTLGITSVPSCYLIYPNGSHGLVNVAKPLRSFFSSHLKSLPDVRKKSLFLPEKSNKEEKSEVVVWKEFDRAKLYTADLESGLHYLLRVELAAHRSLAGAQLKTFRDFVTVVAKLFPGRPAVKKLLETLQEWLANLPLDKIPYNAILDLVNNKMQISGIFLTSHVKWVGCQGSRLELRGYPCSLWKLFHTLTVQASTHPEALAGTGFEGHPQAVLQAIRRYIRTFFGCKECGEHFEEMAKESMDSVKTPDQAVLWLWRKHNMVNSRLAGHLSEDPKFPKVPWPTPDLCPACHEEIKGLDSWNEGQVLLFLKQHYSRDNLVDAYSVDQGSPGEWEAQGREQEEGKGLNPSGKSWRHHDTGSLRPPHILGPRTDLSKSLHHRLDLRLQSPQGPQALKEAKAVVPFLGVGFSSLDMSLCVVLYVASSLFLMIMYFFFRVRSKRWKVRLYHPAV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	N-linked_Glycosylation	SVRSATGNSSAAWLV CCEECCCCCCCCHHH	28.56	-
172	N-linked_Glycosylation	TMIDFLQNHTEGTWP HHHHHHHHCCCCCCC	46.31	-
212	N-linked_Glycosylation	HAIVFESNGSYVGRE EEEEEECCCCEECCE	35.91	-
260	N-linked_Glycosylation	SCYLIYPNGSHGLVN EEEEECCCCCCCCCC	47.86	-
289	Acetylation	SLPDVRKKSLFLPEK CCCCHHHHHHCCCCC	41.65	22902405
303	Phosphorylation	KSNKEEKSEVVVWKE CCCCCCCCCEEEEEE	38.61	-
656	Phosphorylation	GFSSLDMSLCVVLYV CHHHCCHHHHHHHHH	20.48	21659605
666	Phosphorylation	VVLYVASSLFLMIMY HHHHHHHHHHHHHHH	17.25	21659605

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of QSOX2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of QSOX2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of QSOX2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of QSOX2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.