| UniProt ID | QOR_MOUSE | |
|---|---|---|
| UniProt AC | P47199 | |
| Protein Name | Quinone oxidoreductase | |
| Gene Name | Cryz | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 331 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species and enhances their stability. NADPH binding interferes with mRNA binding (By similarity).. | |
| Protein Sequence | MATGQKLMRAIRVFEFGGPEVLKLQSDVVVPVPQSHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSVGDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVGCRGPIEINPRDTMAKETSIIGVSLSSSTKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMILLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MATGQKLMR ------CCHHHHHHH | 22.04 | - | |
| 6 | Malonylation | --MATGQKLMRAIRV --CCHHHHHHHHHHH | 45.66 | 26320211 | |
| 23 | Acetylation | FGGPEVLKLQSDVVV CCCHHHEEECCCEEE | 50.05 | 23954790 | |
| 35 | Phosphorylation | VVVPVPQSHQVLIKV EEEECCCCCEEEEEE | 15.15 | 25521595 | |
| 53 | Phosphorylation | GVNPVETYIRSGAYS CCCCCHHHHHCCCCC | 4.84 | 25195567 | |
| 62 | Ubiquitination | RSGAYSRKPALPYTP HCCCCCCCCCCCCCC | 28.80 | 22790023 | |
| 67 | Phosphorylation | SRKPALPYTPGSDVA CCCCCCCCCCCCCHH | 26.81 | 25521595 | |
| 83 | Acetylation | IIESVGDKVSAFKKG HHHHHHCHHHHHCCC | 31.96 | 23806337 | |
| 83 | Succinylation | IIESVGDKVSAFKKG HHHHHHCHHHHHCCC | 31.96 | 23806337 | |
| 88 | Acetylation | GDKVSAFKKGDRVFC HCHHHHHCCCCEEEE | 56.41 | 155745 | |
| 89 | Acetylation | DKVSAFKKGDRVFCY CHHHHHCCCCEEEEE | 60.64 | 7826009 | |
| 137 | S-palmitoylation | GIPYFTACRALFHSA CCCHHHHHHHHHHHH | 2.07 | 26165157 | |
| 165 | Phosphorylation | SGGVGLATCQIARAH CCCHHHHHHHHHHHC | 15.24 | - | |
| 186 | Acetylation | TAGSEEGKKLVLQNG ECCCHHHHEEEECCC | 46.33 | 23576753 | |
| 186 | Malonylation | TAGSEEGKKLVLQNG ECCCHHHHEEEECCC | 46.33 | 26320211 | |
| 186 | Succinylation | TAGSEEGKKLVLQNG ECCCHHHHEEEECCC | 46.33 | 23806337 | |
| 187 | Ubiquitination | AGSEEGKKLVLQNGA CCCHHHHEEEECCCH | 55.47 | 22790023 | |
| 201 | Acetylation | AHEVFNHKEANYIDK HHHHCCCCCCCCHHE | 60.67 | 23954790 | |
| 208 | Ubiquitination | KEANYIDKIKMSVGD CCCCCHHEEECCCCC | 34.37 | - | |
| 208 | Succinylation | KEANYIDKIKMSVGD CCCCCHHEEECCCCC | 34.37 | - | |
| 208 | Acetylation | KEANYIDKIKMSVGD CCCCCHHEEECCCCC | 34.37 | 23806337 | |
| 208 | Malonylation | KEANYIDKIKMSVGD CCCCCHHEEECCCCC | 34.37 | 26320211 | |
| 210 | Malonylation | ANYIDKIKMSVGDKD CCCHHEEECCCCCCC | 30.75 | 26320211 | |
| 216 | Acetylation | IKMSVGDKDKGVDVI EECCCCCCCCCHHHH | 56.25 | 23201123 | |
| 237 | Acetylation | ENLSNDLKLLSHGGR CCCCHHHHHHHCCCE | 50.69 | 23954790 | |
| 272 | Phosphorylation | ETSIIGVSLSSSTKE CCEEEEEECCCCCHH | 19.81 | 25177544 | |
| 274 | Phosphorylation | SIIGVSLSSSTKEEF EEEEEECCCCCHHHH | 18.09 | 28464351 | |
| 275 | Phosphorylation | IIGVSLSSSTKEEFQ EEEEECCCCCHHHHH | 47.52 | 25195567 | |
| 294 | Acetylation | LLQAGIEKGWVKPVI HHHHCHHHCCCCCCC | 57.03 | 23954790 | |
| 298 | Succinylation | GIEKGWVKPVIGSEY CHHHCCCCCCCCCCC | 27.36 | 23806337 | |
| 298 | Succinylation | GIEKGWVKPVIGSEY CHHHCCCCCCCCCCC | 27.36 | - | |
| 298 | Acetylation | GIEKGWVKPVIGSEY CHHHCCCCCCCCCCC | 27.36 | 23806337 | |
| 321 | Phosphorylation | HEDIIHGSGKTGKMI CCCCCCCCCCCCCEE | 23.97 | 30352176 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QOR_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QOR_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QOR_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of QOR_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...