QCR9_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: QCR9_MOUSE
• UniProt AC: Q8R1I1
• Protein Name: Cytochrome b-c1 complex subunit 9
• Gene Name: Uqcr10
• Organism: Mus musculus (Mouse).
• Sequence Length: 64
• Subcellular Localization: Mitochondrion inner membrane.
• Protein Description: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity)..
• Protein Sequence: MSSPTIPSRLYSLLFRRTSTFALTIAVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSSPTIPSR ------CCCCCHHHH	45.05	27818261
3	Phosphorylation	-----MSSPTIPSRL -----CCCCCHHHHH	25.43	27818261
12	Phosphorylation	TIPSRLYSLLFRRTS CHHHHHHHHHHHCCH	24.16	22817900
44	Phosphorylation	DQGADAIYEHINEGK HHCHHHHHHHCHHCC	11.81	-
59	Acetylation	LWKHIKHKYENKE-- HHHHHHHHHCCCC--	49.62	23864654
63	Acetylation	IKHKYENKE------ HHHHHCCCC------	53.51	23864654

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of QCR9_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of QCR9_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of QCR9_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of QCR9_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.