UniProt ID | QCR6_RAT | |
---|---|---|
UniProt AC | Q5M9I5 | |
Protein Name | Cytochrome b-c1 complex subunit 6, mitochondrial | |
Gene Name | Uqcrh | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 89 | |
Subcellular Localization | Mitochondrion inner membrane . | |
Protein Description | This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1 (By similarity).. | |
Protein Sequence | MGLEDERKMLTGSGDPKEEEEEELVDPLTTVREHCEQLEKCVKARERLESCDRRVSSRSQTEEDCTEELFDFLHARDHCVAHKLFKSLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Acetylation | LTGSGDPKEEEEEEL HCCCCCCHHHHHHHH | 80.60 | 22902405 | |
40 | Acetylation | EHCEQLEKCVKARER HHHHHHHHHHHHHHH | 53.58 | 26302492 | |
43 | Acetylation | EQLEKCVKARERLES HHHHHHHHHHHHHHH | 51.72 | 26302492 | |
50 | Phosphorylation | KARERLESCDRRVSS HHHHHHHHCCHHHHC | 26.38 | 29779826 | |
56 | Phosphorylation | ESCDRRVSSRSQTEE HHCCHHHHCCCCCHH | 20.44 | 23991683 | |
57 | Phosphorylation | SCDRRVSSRSQTEED HCCHHHHCCCCCHHH | 32.85 | 23991683 | |
59 | Phosphorylation | DRRVSSRSQTEEDCT CHHHHCCCCCHHHHH | 43.32 | 27097102 | |
61 | Phosphorylation | RVSSRSQTEEDCTEE HHHCCCCCHHHHHHH | 42.46 | 27097102 | |
66 | Phosphorylation | SQTEEDCTEELFDFL CCCHHHHHHHHHHHH | 44.83 | 30181290 | |
83 | Acetylation | RDHCVAHKLFKSLK- HHHHHHHHHHHHCC- | 45.97 | 25786129 | |
86 | Acetylation | CVAHKLFKSLK---- HHHHHHHHHCC---- | 66.37 | 22902405 | |
87 | Phosphorylation | VAHKLFKSLK----- HHHHHHHHCC----- | 33.77 | 23991683 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of QCR6_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of QCR6_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of QCR6_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of QCR6_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...