PYRD_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PYRD_DROME
• UniProt AC: P32748
• Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial
• Gene Name: Dhod
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 405
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .
• Protein Description: Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor..
• Protein Sequence: MDQDHLKNAKNATRRVGRLRSLGIVTVGGAALVAGITAYKNQDQLFRTFVMPAVRLLPAEASHQLAVLACKYRLCPVSQYHDDQNLHTSFFGRMLSNPIGIAAGFDKNAEAVDGLQDLGFGFIEVGTVTPAAQEGNPKPRVFRLTEDKAIINRYGFNSDGHQAVLQRLRLLRKKENFNGVVGVNLGRNKTTMSPIADYVQGVRVFGPVADYLVINVSSPNTKGLRDMQSKEKLRELLEQVNDTKSSLDKNKNVPILLKLSPDLSLDDMKDIVWVIKRKKSRVDGLIVSNTTVSRENIEKNKLAEETGGLSGPPLKARSTEMIAQMYQLTDGKIPIIGVGGVASGYDAYEKIEAGASYVQIYTALVYEGPALVEDIKAELSALITRLGHTNVADVVGTNSKFYLPK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	AALVAGITAYKNQDQ HHHHEEEEEECCHHH	24.02	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PYRD_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PYRD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PYRD_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of PYRD_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.