| UniProt ID | PXMP4_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y6I8 | |
| Protein Name | Peroxisomal membrane protein 4 | |
| Gene Name | PXMP4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 212 | |
| Subcellular Localization |
Peroxisome membrane Multi-pass membrane protein. |
|
| Protein Description | ||
| Protein Sequence | MAAPPQLRALLVVVNALLRKRRYHAALAVLKGFRNGAVYGAKIRAPHALVMTFLFRNGSLQEKLWAILQATYIHSWNLARFVFTYKGLRALQSYIQGKTYPAHAFLAAFLGGILVFGENNNINSQINMYLLSRVLFALSRLAVEKGYIPEPRWDPFPLLTAVVWGLVLWLFEYHRSTLQPSLQSSMTYLYEDSNVWHDISDFLVYNKSRPSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Acetylation | HAALAVLKGFRNGAV HHHHHHHHCCCCCCC | 49.78 | 7467853 | |
| 57 | N-linked_Glycosylation | VMTFLFRNGSLQEKL HHHHHHCCCCHHHHH | 36.75 | UniProtKB CARBOHYD | |
| 60 | Phosphorylation | FLFRNGSLQEKLWAI HHHCCCCHHHHHHHH | 8.92 | 24719451 | |
| 60 (in isoform 2) | Phosphorylation | - | 8.92 | 24719451 | |
| 63 | Phosphorylation | RNGSLQEKLWAILQA CCCCHHHHHHHHHHH | 36.05 | 24719451 | |
| 63 (in isoform 2) | Phosphorylation | - | 36.05 | 24719451 | |
| 68 | Phosphorylation | QEKLWAILQATYIHS HHHHHHHHHHHHHHH | 1.88 | 24719451 | |
| 68 (in isoform 2) | Phosphorylation | - | 1.88 | 24719451 | |
| 84 | Phosphorylation | NLARFVFTYKGLRAL HHHHHHHCHHHHHHH | 21.01 | 26074081 | |
| 85 | Phosphorylation | LARFVFTYKGLRALQ HHHHHHCHHHHHHHH | 7.50 | 26074081 | |
| 86 | Ubiquitination | ARFVFTYKGLRALQS HHHHHCHHHHHHHHH | 48.70 | 22817900 | |
| 206 | N-linked_Glycosylation | ISDFLVYNKSRPSN- HHHHHHEECCCCCC- | 28.48 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PXMP4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PXMP4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PXMP4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PXMP4_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
