UniProt ID | PURG_HUMAN | |
---|---|---|
UniProt AC | Q9UJV8 | |
Protein Name | Purine-rich element-binding protein gamma | |
Gene Name | PURG | |
Organism | Homo sapiens (Human). | |
Sequence Length | 347 | |
Subcellular Localization | Nucleus. | |
Protein Description | ||
Protein Sequence | MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Phosphorylation | DIQKKRFYLDVKQSS CCCCCEEEEEECHHC | 13.16 | - | |
153 | Phosphorylation | SRRRQKHSAPSPPVS HHHCHHCCCCCCCCC | 49.24 | 27732954 | |
156 | Phosphorylation | RQKHSAPSPPVSVGS CHHCCCCCCCCCCCC | 41.37 | 20363803 | |
160 | Phosphorylation | SAPSPPVSVGSEEHP CCCCCCCCCCCCCCC | 26.91 | 20363803 | |
163 | Phosphorylation | SPPVSVGSEEHPHSV CCCCCCCCCCCCCCC | 37.34 | 20363803 | |
169 | Phosphorylation | GSEEHPHSVLKTDYI CCCCCCCCCCCCCEE | 33.33 | 27732954 | |
182 | Ubiquitination | YIERDNRKYYLDLKE EEEECCEEEEEECCC | 44.49 | 23000965 | |
188 | Methylation | RKYYLDLKENQRGRF EEEEEECCCCCCCHH | 55.04 | 66700469 | |
188 | Ubiquitination | RKYYLDLKENQRGRF EEEEEECCCCCCCHH | 55.04 | 23000965 | |
265 | Phosphorylation | PLELPEGTSFRVDNK CCCCCCCCCEEECCE | 24.03 | 30206219 | |
266 | Phosphorylation | LELPEGTSFRVDNKR CCCCCCCCEEECCEE | 23.16 | 30206219 | |
275 | Phosphorylation | RVDNKRFYFDVGSNK EECCEEEEEEECCCE | 11.69 | 22461510 | |
339 | Phosphorylation | RMDGRKASGEEQECL HCCCCCCCCCCCCCC | 50.18 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PURG_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PURG_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PURG_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PURG_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...