UniProt ID | PUMP6_ARATH | |
---|---|---|
UniProt AC | Q9FY68 | |
Protein Name | Mitochondrial uncoupling protein 6 | |
Gene Name | PUMP6 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 337 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein. |
|
Protein Description | PUMPS are mitochondrial transporter proteins that create proton leaks across the inner mitochondrial membrane, thus uncoupling oxidative phosphorylation. This leads to a decrease in the efficiency of oxidative phosphorylation and an increase in heat production. May be involved in protecting plant cells against oxidative stress damage (By similarity). Recombinant PUMP6, reconstituted into liposomes, transports a wide range of dicarboxylic acids including malate, oxaloacetate and succinate as well as phosphate, sulfate and thiosulfate. However, it is unknown if these transports are of any biological significance in vivo.. | |
Protein Sequence | MGFKPFLEGGIAAIIAGALTHPLDLIKVRMQLQGEHSFSLDQNPNPNLSLDHNLPVKPYRPVFALDSLIGSISLLPLHIHAPSSSTRSVMTPFAVGAHIVKTEGPAALFSGVSATILRQMLYSATRMGIYDFLKRRWTDQLTGNFPLVTKITAGLIAGAVGSVVGNPADVAMVRMQADGSLPLNRRRNYKSVVDAIDRIARQEGVSSLWRGSWLTVNRAMIVTASQLATYDHVKEILVAGGRGTPGGIGTHVAASFAAGIVAAVASNPIDVVKTRMMNADKEIYGGPLDCAVKMVAEEGPMALYKGLVPTATRQGPFTMILFLTLEQVRGLLKDVKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
244 | Phosphorylation | LVAGGRGTPGGIGTH EEECCCCCCCCHHHH | 27545962 | ||
250 | Phosphorylation | GTPGGIGTHVAASFA CCCCCHHHHHHHHHH | 27545962 | ||
255 | Phosphorylation | IGTHVAASFAAGIVA HHHHHHHHHHHHHHH | 27545962 | ||
266 | Phosphorylation | GIVAAVASNPIDVVK HHHHHHHCCCHHHHH | 27545962 | ||
274 | Phosphorylation | NPIDVVKTRMMNADK CCHHHHHHEECCCCC | 27545962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PUMP6_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PUMP6_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PUMP6_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PUMP6_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...