dbPTM

PUB9_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PUB9_ARATH
UniProt AC	Q9SRT0
Protein Name	U-box domain-containing protein 9
Gene Name	PUB9
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	460
Subcellular Localization	Nucleus . Cell membrane . Relocates from nucleus to plasma membrane when phosphorylated.
Protein Description	Functions as an E3 ubiquitin ligase (By similarity). May be involved in the abscisic acid-mediated signaling pathway, at least during germination..
Protein Sequence	MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKMAKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMISKWCKKNGLETKSQYHPNLVNEDETVTRSDREIFNSLLCKVSSSNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLLHGSNPDEKLQEDVVTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
225	Phosphorylation	VNPLLHGSNPDEKLQ HHHHHCCCCCCHHHH	34.15	30291188
457	Phosphorylation	LRKAMNLTHTA---- HHHHHCCCCCC----	16.51	25561503
459	Phosphorylation	KAMNLTHTA------ HHHCCCCCC------	28.91	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PUB9_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PUB9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PUB9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PUB9_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PUB9_ARATH

Related Literatures of Post-Translational Modification