| UniProt ID | PUB9_ARATH | |
|---|---|---|
| UniProt AC | Q9SRT0 | |
| Protein Name | U-box domain-containing protein 9 | |
| Gene Name | PUB9 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 460 | |
| Subcellular Localization | Nucleus . Cell membrane . Relocates from nucleus to plasma membrane when phosphorylated. | |
| Protein Description | Functions as an E3 ubiquitin ligase (By similarity). May be involved in the abscisic acid-mediated signaling pathway, at least during germination.. | |
| Protein Sequence | MAKTGVFDSDPTAIAKAKELKREMKKLLIKIDDEDDLGVQTIDQLQDALSALREATMRKMAKSSSLEMLETVSCPEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIREMISKWCKKNGLETKSQYHPNLVNEDETVTRSDREIFNSLLCKVSSSNLQDQKSAAKELRLLTRKGTEFRALFGESPDEITRLVNPLLHGSNPDEKLQEDVVTTLLNISIHDDSNKKLVCENPNVIPLLIDALRRGTVATRSNAAAAIFTLSALDSNKVLIGKSGILKPLIDLLEEGNPLAIKDVAAAIFTLCIAHENRSRAVRDGAVRVLGKKISNGLYVDELLAILAMLVTHWKAVEELGELGGVSWLLKITRESECKRNKENAIVILHTICFSDRTKWKEIKEEENAHGTITKLSREGTSRAQRKANGILDRLRKAMNLTHTA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 225 | Phosphorylation | VNPLLHGSNPDEKLQ HHHHHCCCCCCHHHH | 34.15 | 30291188 | |
| 457 | Phosphorylation | LRKAMNLTHTA---- HHHHHCCCCCC---- | 16.51 | 25561503 | |
| 459 | Phosphorylation | KAMNLTHTA------ HHHCCCCCC------ | 28.91 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PUB9_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PUB9_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PUB9_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PUB9_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...