PUB30_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PUB30_ARATH
• UniProt AC: Q058P4
• Protein Name: U-box domain-containing protein 30
• Gene Name: PUB30
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 448
• Protein Description: Functions as an E3 ubiquitin ligase..
• Protein Sequence: MPMFQPLKRDGLIGFEGGGDGQVLDLDTAVKDGVLGGVNGGGVGVVDEKLDLKKMIKELDLQDIPSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQELWDDTVTPNKTLHHLIYTWFSQKYVLMKKRSEDVQGRAIEILGTLKKAKGQARVHALSELKQIVIAHLMARKTVVEEGGVSVISSLLGPFTSHAVGSEVVAILVSLDLDSDSKSGLMQPAKVSLIVDMLNDGSNETKINCARLIRGLVEEKGFRAELVSSHSLLVGLMRLVKDKRHRNGVSPALRLLKPISVHKQVRSLMVSIGAVPQLVDILPSLDPECLELALFVLDALCTDVEGRVAVKDSANTIPYTVRVLMRVSENCTNYALSILWSVCKLAPEECSPLAVEVGLAAKLLLVIQSGCDAALKQRSAELLKLCSLHYSDTMFISKCKLTRTIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
273	Phosphorylation	AELVSSHSLLVGLMR CCHHHHHHHHHHHHH	25.91	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PUB30_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PUB30_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PUB30_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBC9_ARATH	UBC9	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.