| UniProt ID | PTOV1_MOUSE | |
|---|---|---|
| UniProt AC | Q91VU8 | |
| Protein Name | Prostate tumor-overexpressed gene 1 protein homolog | |
| Gene Name | Ptov1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 416 | |
| Subcellular Localization | Cell membrane. Cytoplasm, perinuclear region. Nucleus. Translocates from the cytoplasm to the nucleus at the onset of S-phase. Also localizes to lipid rafts.. | |
| Protein Description | May activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation (By similarity).. | |
| Protein Sequence | MVRPRRAPHRSGAGGPLGGRGRPPRPLVVRAVRSRSWPGGPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVNEHRLSNKLLAWSGVLEWQEKRRPFSDSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQAVGPGGVHSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSLEQEQQQRGMGG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | LVVRAVRSRSWPGGP EEEEEECCCCCCCCC | 24.86 | 23984901 | |
| 36 | Phosphorylation | VRAVRSRSWPGGPRG EEEECCCCCCCCCCC | 38.58 | 23684622 | |
| 53 | Phosphorylation | PPRIRARSAPPMEGA CCCCCCCCCCCCCCC | 44.11 | 25521595 | |
| 72 | Phosphorylation | ALGPIGPSSPGLTLG ECCCCCCCCCCCCCC | 43.91 | 26643407 | |
| 73 | Phosphorylation | LGPIGPSSPGLTLGG CCCCCCCCCCCCCCC | 26.56 | 26824392 | |
| 77 | Phosphorylation | GPSSPGLTLGGLAVN CCCCCCCCCCCEEEC | 29.31 | 23984901 | |
| 89 | Phosphorylation | AVNEHRLSNKLLAWS EECCHHHHHCHHHHH | 31.69 | 25777480 | |
| 114 | Ubiquitination | PFSDSTAKLKRTLPC CCCCCHHHHHHHCCC | 55.41 | - | |
| 176 | Ubiquitination | NRDCDSLKGLCRIMG CCCHHHHHHHHHHHC | 54.51 | 22790023 | |
| 207 | Phosphorylation | VRVLMLLYSSKKKIF HHHHHHHHHCCCEEE | 13.62 | 29472430 | |
| 208 | Phosphorylation | RVLMLLYSSKKKIFM HHHHHHHHCCCEEEE | 35.33 | 29472430 | |
| 209 | Phosphorylation | VLMLLYSSKKKIFMG HHHHHHHCCCEEEEE | 34.63 | 29472430 | |
| 237 | Ubiquitination | RQVITTRKQAVGPGG HHHHHHCCCCCCCCC | 40.28 | 22790023 | |
| 275 | Phosphorylation | EPRPEPNSRSKRWLP CCCCCCCCCCCCCCC | 48.96 | - | |
| 277 | Phosphorylation | RPEPNSRSKRWLPSH CCCCCCCCCCCCCCC | 26.79 | - | |
| 283 | Phosphorylation | RSKRWLPSHVYVNQG CCCCCCCCCEEECCC | 24.34 | 26239621 | |
| 286 | Phosphorylation | RWLPSHVYVNQGEIL CCCCCCEEECCCCEE | 6.56 | 26239621 | |
| 331 | Ubiquitination | LVQFHFTKDMETLKS EEEEEECCCHHHHHH | 54.88 | 22790023 | |
| 337 | Ubiquitination | TKDMETLKSLCRIMD CCCHHHHHHHHHHHH | 49.12 | 22790023 | |
| 368 | Phosphorylation | VRVLMLLYSSEKKIF HHEHHHHHCCCCEEE | 13.24 | 25338131 | |
| 369 | Phosphorylation | RVLMLLYSSEKKIFI HEHHHHHCCCCEEEE | 31.80 | 25338131 | |
| 370 | Phosphorylation | VLMLLYSSEKKIFIG EHHHHHCCCCEEEEE | 39.62 | 25338131 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTOV1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTOV1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTOV1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PTOV1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...