UniProt ID | PTMA_RAT | |
---|---|---|
UniProt AC | P06302 | |
Protein Name | Prothymosin alpha | |
Gene Name | Ptma | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 112 | |
Subcellular Localization | Nucleus. | |
Protein Description | Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections.. | |
Protein Sequence | MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAQNEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAPTGKRVAEDDEDDDVETKKQKKTDEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MSDAAVDT -------CCCCCCCC | 8.05 | - | |
2 | Acetylation | ------MSDAAVDTS ------CCCCCCCCC | 35.64 | 3855555 | |
2 | Phosphorylation | ------MSDAAVDTS ------CCCCCCCCC | 35.64 | 27097102 | |
8 | Phosphorylation | MSDAAVDTSSEITTK CCCCCCCCCCCCCHH | 27.79 | 23298284 | |
9 | Phosphorylation | SDAAVDTSSEITTKD CCCCCCCCCCCCHHH | 22.85 | 23298284 | |
10 | Phosphorylation | DAAVDTSSEITTKDL CCCCCCCCCCCHHHH | 34.80 | 22673903 | |
13 | Phosphorylation | VDTSSEITTKDLKEK CCCCCCCCHHHHHHH | 24.60 | 22673903 | |
14 | Phosphorylation | DTSSEITTKDLKEKK CCCCCCCHHHHHHHH | 28.37 | 25575281 | |
15 | Acetylation | TSSEITTKDLKEKKE CCCCCCHHHHHHHHH | 53.03 | 22902405 | |
15 | Succinylation | TSSEITTKDLKEKKE CCCCCCHHHHHHHHH | 53.03 | - | |
15 | Succinylation | TSSEITTKDLKEKKE CCCCCCHHHHHHHHH | 53.03 | - | |
20 | Acetylation | TTKDLKEKKEVVEEA CHHHHHHHHHHHHHH | 53.28 | 22902405 | |
102 | Phosphorylation | DEDDDVETKKQKKTD CCCCCHHHHHHHCCC | 43.31 | - | |
103 | Acetylation | EDDDVETKKQKKTDE CCCCHHHHHHHCCCC | 39.44 | - | |
103 | Succinylation | EDDDVETKKQKKTDE CCCCHHHHHHHCCCC | 39.44 | 26843850 | |
108 | Phosphorylation | ETKKQKKTDEDD--- HHHHHHCCCCCC--- | 52.21 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTMA_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTMA_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTMA_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PTMA_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...