dbPTM

PTGDS_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PTGDS_RAT
UniProt AC	P22057
Protein Name	Prostaglandin-H2 D-isomerase
Gene Name	Ptgds
Organism	Rattus norvegicus (Rat).
Sequence Length	189
Subcellular Localization	Rough endoplasmic reticulum. Nucleus membrane. Golgi apparatus. Cytoplasm, perinuclear region. Secreted. Detected on rough endoplasmic reticulum of arachnoid and menigioma cells. Localized to the nuclear envelope, Golgi apparatus, secretory vesicles
Protein Description	Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system..
Protein Sequence	MAALPMLWTGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKELLFMCQTVVAPSTEGGLNLTSTFLRKNQCETKVMVLQPAGVPGQYTYNSPHWGSFHSLSVVETDYDEYAFLFSKGTKGPGQDFRMATLYSRAQLLKEELKEKFITFSKDQGLTEEDIVFLPQPDKCIQE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	Pyrrolidone_carboxylic_acid	GFPQTPAQGHDTVQP CCCCCCCCCCCCCCC	51.46	-
25	Pyrrolidone_carboxylic_acid	GFPQTPAQGHDTVQP CCCCCCCCCCCCCCC	51.46	11565799
25	Pyrrolidone_carboxylic_acid	GFPQTPAQGHDTVQP CCCCCCCCCCCCCCC	51.46	11565799
51	N-linked_Glycosylation	YSAGLASNSSWFREK HHHCCCCCCHHHHHH	34.16	2642896
78	N-linked_Glycosylation	PSTEGGLNLTSTFLR CCCCCCCCCHHHHHH	44.54	2642896

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PTGDS_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PTGDS_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PTGDS_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PTGDS_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PTGDS_RAT

Related Literatures of Post-Translational Modification