UniProt ID | PTG3L_HUMAN | |
---|---|---|
UniProt AC | E9PB15 | |
Protein Name | Putative protein PTGES3L | |
Gene Name | PTGES3L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 166 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDSTDVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKKVSTKRPPPAMDDLDDDSDSADDATSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MFSLPLNCSP -----CCCCCCCCCH | 27732954 | ||
9 | Phosphorylation | FSLPLNCSPDHIRRG CCCCCCCCHHHHCCC | 27732954 | ||
106 | Phosphorylation | FYAKVNSKPVWLSVD EEEEECCCCEEEEEE | 22673903 | ||
134 | Phosphorylation | ELAHVEHYAELLKKV HHHHHHHHHHHHHHH | 28796482 | ||
157 | Phosphorylation | MDDLDDDSDSADDAT CCCCCCCCCCCCHHC | 23663014 | ||
159 | Phosphorylation | DLDDDSDSADDATSN CCCCCCCCCCHHCCC | 23663014 | ||
164 | Phosphorylation | SDSADDATSN----- CCCCCHHCCC----- | 23663014 | ||
165 | Phosphorylation | DSADDATSN------ CCCCHHCCC------ | 23663014 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTG3L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTG3L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTG3L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PTG3L_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...