UniProt ID | PSS_SCHPO | |
---|---|---|
UniProt AC | O94584 | |
Protein Name | CDP-diacylglycerol--serine O-phosphatidyltransferase | |
Gene Name | pps1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 240 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Cytoplasmic vesicle membrane. During log-phase growth, concentrates at the cell and nuclear peripheries as well endoplasmic reticulum membranes, while in stationary-phase cells, is redistri |
|
Protein Description | Phosphatidylserine synthase involved in the regulation of processes such as cell morphology, cytokinesis, actin cytoskeleton, and cell wall remodeling and integrity. Also plays a role in the physiological adaptations required for stationary-phase survival.. | |
Protein Sequence | MVRSRVSPGLKLQSDASNQSNDKENKLLAYVNDNRHFSLIRALHLADLITLMNGFCGVMSIFSSLRYCLSGQQSAFHLWNAMYFMPFALFFDFLDGKVARWRGKSSLMGQELDSLADLISFGVSPAVFAFCCGFQTFLDTVILSLFVLCGLTRLARFNVSVNSIPKDGSGKSQFFEGTPIPTTLSLVTVCGVCILKGKTHENLPWGEWCGNTPFAFHPLVVLFVLSGIAMTSKKLKVPKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MVRSRVSPGLKLQS -CCCCCCCCCCCCCC | 16.49 | 29996109 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSS_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSS_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSS_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PSS_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...