| UniProt ID | PSMF1_RAT | |
|---|---|---|
| UniProt AC | Q5XIU5 | |
| Protein Name | Proteasome inhibitor PI31 subunit | |
| Gene Name | Psmf1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 271 | |
| Subcellular Localization | Cytoplasm. Endoplasmic reticulum. | |
| Protein Description | Plays an important role in control of proteasome function. Inhibits the hydrolysis of protein and peptide substrates by the 20S proteasome. Also inhibits the activation of the proteasome by the proteasome regulatory proteins PA700 and PA28 (By similarity).. | |
| Protein Sequence | MAGLEVLFASAAPAMTCPQDALVCFLHWEVVTNGYYGLGTGDQPDPNDKKSELLPAEWNSNKELYALRYESKDGARKLLLKAVSVENGMIINVLEHGTQQVADLTLNLDDYIDAEDLSDFHRTYKNSEELRSRIRSGIITPIHEQWEKVRLSSPPREFPPATAREVDPLRISSHHPHTSRQPTWRDPLSPFAVGGEDLDPFGCQRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAGLEVLFA ------CCCCEEEEC | 31.14 | - | |
| 136 | Phosphorylation | ELRSRIRSGIITPIH HHHHHHHHCCCCCHH | 31.79 | 25575281 | |
| 140 | Phosphorylation | RIRSGIITPIHEQWE HHHHCCCCCHHHHHH | 17.80 | 25575281 | |
| 152 | Phosphorylation | QWEKVRLSSPPREFP HHHHHCCCCCCCCCC | 30.18 | 25403869 | |
| 153 | Phosphorylation | WEKVRLSSPPREFPP HHHHCCCCCCCCCCC | 43.44 | 21738781 | |
| 162 | Phosphorylation | PREFPPATAREVDPL CCCCCCCCCCCCCCC | 31.83 | 28689409 | |
| 172 | Phosphorylation | EVDPLRISSHHPHTS CCCCCCCCCCCCCCC | 19.72 | 25575281 | |
| 173 | Phosphorylation | VDPLRISSHHPHTSR CCCCCCCCCCCCCCC | 24.36 | 25575281 | |
| 178 | Phosphorylation | ISSHHPHTSRQPTWR CCCCCCCCCCCCCCC | 30.01 | 25575281 | |
| 179 | Phosphorylation | SSHHPHTSRQPTWRD CCCCCCCCCCCCCCC | 26.36 | 25575281 | |
| 183 | Phosphorylation | PHTSRQPTWRDPLSP CCCCCCCCCCCCCCC | 25.46 | 23984901 | |
| 189 | Phosphorylation | PTWRDPLSPFAVGGE CCCCCCCCCCCCCCC | 24.30 | 29779826 | |
| 205 | Methylation | LDPFGCQRGGMIVDP CCCCCCCCCCEEECC | 47.94 | - | |
| 219 | Asymmetric dimethylarginine | PLRSGFPRALIDPSS CHHCCCCHHHCCCCC | 39.50 | - | |
| 219 | Methylation | PLRSGFPRALIDPSS CHHCCCCHHHCCCCC | 39.50 | - | |
| 231 | Methylation | PSSGLPNRLPPGAVP CCCCCCCCCCCCCCC | 46.78 | - | |
| 252 | Phosphorylation | PFGPIGTSPSGPNPD CCCCCCCCCCCCCCC | 16.32 | 24259510 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMF1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMF1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMF1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PSMF1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
