PSMD9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSMD9_SCHPO
• UniProt AC: O94393
• Protein Name: Probable 26S proteasome regulatory subunit p27
• Gene Name: nas2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 213
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the 19S regulatory complex (RC)..
• Protein Sequence: MDEFKQLDLKKREIENRLNELEGVLLKERVTMDTPLLTEDGFPRSDIDVPSIRTARHEIITLRNDHRELEDQIKKVLEKVFSGFSKESLAANDETKLAQEADPLNFNAANYNMNDIISRSKILGRVKPFCVVDSVAVESPAQEAGLCIGDELVHVQNVTSLSELPTFISNNVNKTLDVLLIRGYSADGSTNLVELKLTPHKWQGPGLLGCHLR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
118	Phosphorylation	YNMNDIISRSKILGR CCHHHHHHHHHHCCC	30.73	21712547
120	Phosphorylation	MNDIISRSKILGRVK HHHHHHHHHHCCCCC	19.77	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSMD9_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSMD9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSMD9_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CBH1_SCHPO	cbh1	physical	26771498
LCMT1_SCHPO	ppm1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.