| UniProt ID | PSMD8_MOUSE | |
|---|---|---|
| UniProt AC | Q9CX56 | |
| Protein Name | 26S proteasome non-ATPase regulatory subunit 8 | |
| Gene Name | Psmd8 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 353 | |
| Subcellular Localization | ||
| Protein Description | Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.. | |
| Protein Sequence | MFIKGRAAKTPRGEPRRSSRGGRKLAVVAPPPVLGSTSRPHFRRESIARRRCRKSGRRLAASRKMAATAATVNGSTTVSSSGPAATSVGILQAAAGMYEQLKDEWNRKNPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILCKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFAEATRILFFSTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDSTIPSTELAKQVIEYARQLEMIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 114 | Ubiquitination | RKNPNLSKCGEELGR HHCCCHHHHHHHHHH | 49.80 | 22790023 | |
| 138 | Ubiquitination | FLPTTGTKLTKQQLI CCCCCCCCCCHHHHH | 56.34 | 22790023 | |
| 141 | Ubiquitination | TTGTKLTKQQLILAR CCCCCCCHHHHHHHH | 46.62 | - | |
| 141 | Acetylation | TTGTKLTKQQLILAR CCCCCCCHHHHHHHH | 46.62 | - | |
| 141 | Malonylation | TTGTKLTKQQLILAR CCCCCCCHHHHHHHH | 46.62 | 26320211 | |
| 284 | Acetylation | CIEKAYEKILFAEAT HHHHHHHHHHHHHHH | 31.84 | - | |
| 297 | Phosphorylation | ATRILFFSTPKKMTD HHHHEEECCCCCHHH | 36.14 | 27180971 | |
| 298 | Phosphorylation | TRILFFSTPKKMTDY HHHEEECCCCCHHHH | 33.69 | 26745281 | |
| 300 | Ubiquitination | ILFFSTPKKMTDYAK HEEECCCCCHHHHHH | 56.09 | - | |
| 300 | Malonylation | ILFFSTPKKMTDYAK HEEECCCCCHHHHHH | 56.09 | 26320211 | |
| 307 | Malonylation | KKMTDYAKKRGWVLG CCHHHHHHHHCCEEC | 36.45 | 26320211 | |
| 340 | Ubiquitination | IPSTELAKQVIEYAR CCHHHHHHHHHHHHH | 58.69 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSMD8_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSMD8_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSMD8_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PSMD8_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...