PSF2_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSF2_DROME
• UniProt AC: Q9VQY9
• Protein Name: Probable DNA replication complex GINS protein PSF2
• Gene Name: Psf2
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 203
• Subcellular Localization: Nucleus.
• Protein Description: The GINS complex plays an essential role in the initiation of DNA replication..
• Protein Sequence: MDPSIIEFIGEKCMISIIPNFSNEPLHLIYGPVGPFRAGFPVFVPLWMATHLRKQQKCRIVPPEWMDMDILEEIKEEEKRSKFFTKMPCEHYMVVAQLVMSTAPDDVPRCEELRTVIKDIFDIRESKLRTSIDAFIKGEGTYAKLDNLTLLEIHSVRPILPYSLDHIARYQRTATASQRDTSMLSASMAGSSSGPNSNSLFSQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PSF2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSF2_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSF2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSF2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MCM3_DROME	Mcm3	physical	16798881
MCM6_DROME	Mcm6	physical	16798881
MCM4_DROME	dpa	physical	16798881
MCM7_DROME	Mcm7	physical	16798881
MCM2_DROME	Mcm2	physical	16798881
MCM5_DROME	Mcm5	physical	16798881

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.