dbPTM

PSBH_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PSBH_ARATH
UniProt AC	P56780
Protein Name	Photosystem II reaction center protein H {ECO:0000255\|HAMAP-Rule:MF_00752}
Gene Name	psbH {ECO:0000255\|HAMAP-Rule:MF_00752}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	73
Subcellular Localization	Plastid, chloroplast thylakoid membrane Single-pass membrane protein .
Protein Description	One of the components of the core complex of photosystem II (PSII), required for its stability and/or assembly. PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation..
Protein Sequence	MATQTVEDSSRSGPRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISVN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATQTVEDS ------CCCCCCCCC	14.39	22223895
3	Phosphorylation	-----MATQTVEDSS -----CCCCCCCCCC	24.39	19880383
5	Phosphorylation	---MATQTVEDSSRS ---CCCCCCCCCCCC	22.85	19880383
9	Phosphorylation	ATQTVEDSSRSGPRS CCCCCCCCCCCCCCC	17.72	19376835
10	Phosphorylation	TQTVEDSSRSGPRST CCCCCCCCCCCCCCC	42.67	19376835
12	Phosphorylation	TVEDSSRSGPRSTTV CCCCCCCCCCCCCHH	55.91	19376835
16	Phosphorylation	SSRSGPRSTTVGKLL CCCCCCCCCHHHHHH	31.40	19376835
17	Phosphorylation	SRSGPRSTTVGKLLK CCCCCCCCHHHHHHH	27.12	19376835
18	Phosphorylation	RSGPRSTTVGKLLKP CCCCCCCHHHHHHHH	28.62	19376835
28	Phosphorylation	KLLKPLNSEYGKVAP HHHHHHCCCCCCCCC	39.62	19376835
30	Phosphorylation	LKPLNSEYGKVAPGW HHHHCCCCCCCCCCC	23.28	19376835
30	Nitration	LKPLNSEYGKVAPGW HHHHCCCCCCCCCCC	23.28	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PSBH_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
3	T	Phosphorylation	11113141
Phosphorylation at Thr-3 is not light-dependent and is probably necessary for subsequent phosphorylation at Thr-5.
3	T	Phosphorylation	11113141
Phosphorylation at Thr-5 but not Thr-3 is performed by STN8.
5	T	Phosphorylation	11113141
Hyperphosphorylation at Thr-5 is rapidly reversible upon light/dark transitions.
5	T	Phosphorylation	11113141
Phosphorylation at Thr-3 is not light-dependent and is probably necessary for subsequent phosphorylation at Thr-5.
5	T	Phosphorylation	11113141
Phosphorylation at Thr-5 but not Thr-3 is performed by STN8.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PSBH_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PSBH_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PSBH_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-3 AND THR-5, AND MASSSPECTROMETRY.	19376835 [Abstract]
"Mass spectrometric resolution of reversible protein phosphorylationin photosynthetic membranes of Arabidopsis thaliana."; Vener A.V., Harms A., Sussman M.R., Vierstra R.D.; J. Biol. Chem. 276:6959-6966(2001). Cited for: PROTEIN SEQUENCE OF 2-11, AND PHOSPHORYLATION AT THR-3 AND THR-5.	11113141 [Abstract]