PSA7B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA7B_ARATH
• UniProt AC: O24616
• Protein Name: Proteasome subunit alpha type-7-B
• Gene Name: PAD2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 250
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity..
• Protein Sequence: MARYDRAITVFSPDGHLFQVEYALEAVRKGNAAVGVRGTDTVVLAVEKKSTPKLQDSRSARKIVSLDNHIALACAGLKADARVLINKARIECQSHRLTLEDPVTVEYITRYIAGLQQKYTQSGGVRPFGLSTLIVGFDPYSRLPSLYQTDPSGTFSAWKANATGRNSNSIREFLEKNYKESSGQETIKLAIRALLEVVESGGKNIEVAVMTREETGLRQLEEAEIDAIVAKIEAEKAAAEAAKKGPPKET

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
119	Phosphorylation	IAGLQQKYTQSGGVR HHHHHHHHHCCCCCC	12.98	23172892
120	Phosphorylation	AGLQQKYTQSGGVRP HHHHHHHHCCCCCCC	24.24	23172892
122	Phosphorylation	LQQKYTQSGGVRPFG HHHHHHCCCCCCCCC	29.70	23172892
131	Phosphorylation	GVRPFGLSTLIVGFD CCCCCCEEEEEEEEC	22.88	23172892
132	Phosphorylation	VRPFGLSTLIVGFDP CCCCCEEEEEEEECC	26.08	23172892
140	Phosphorylation	LIVGFDPYSRLPSLY EEEEECCCCCCCCCE	14.31	23172892
141	Phosphorylation	IVGFDPYSRLPSLYQ EEEECCCCCCCCCEE	32.50	23172892
147	Phosphorylation	YSRLPSLYQTDPSGT CCCCCCCEECCCCCC	17.44	26811356
154	Phosphorylation	YQTDPSGTFSAWKAN EECCCCCCCEEEECC	20.82	26811356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA7B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA7B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA7B_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PSA7B_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.