UniProt ID | PSA6_MOUSE | |
---|---|---|
UniProt AC | Q9QUM9 | |
Protein Name | Proteasome subunit alpha type-6 | |
Gene Name | Psma6 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 246 | |
Subcellular Localization | Cytoplasm . Nucleus . Colocalizes with TRIM5 in cytoplasmic bodies. | |
Protein Description | Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).. | |
Protein Sequence | MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSRGSSAGF ------CCCCCCCCC | 45.40 | 23527152 | |
5 | Phosphorylation | ---MSRGSSAGFDRH ---CCCCCCCCCCCE | 18.86 | 25266776 | |
5 | O-linked_Glycosylation | ---MSRGSSAGFDRH ---CCCCCCCCCCCE | 18.86 | 22556278 | |
6 | Phosphorylation | --MSRGSSAGFDRHI --CCCCCCCCCCCEE | 34.92 | 29176673 | |
14 | Phosphorylation | AGFDRHITIFSPEGR CCCCCEEEEECCCCC | 15.16 | 28066266 | |
17 | Phosphorylation | DRHITIFSPEGRLYQ CCEEEEECCCCCEEE | 20.42 | 28066266 | |
23 | Phosphorylation | FSPEGRLYQVEYAFK ECCCCCEEEEEEHHH | 14.78 | 22817900 | |
30 | Acetylation | YQVEYAFKAINQGGL EEEEEHHHHHHCCCC | 39.94 | 23954790 | |
45 | Ubiquitination | TSVAVRGKDCAVIVT EEEEECCCCEEEEEE | 38.78 | - | |
45 | Malonylation | TSVAVRGKDCAVIVT EEEEECCCCEEEEEE | 38.78 | 26320211 | |
47 | S-nitrosocysteine | VAVRGKDCAVIVTQK EEECCCCEEEEEECC | 3.57 | - | |
47 | Glutathionylation | VAVRGKDCAVIVTQK EEECCCCEEEEEECC | 3.57 | 24333276 | |
47 | S-nitrosylation | VAVRGKDCAVIVTQK EEECCCCEEEEEECC | 3.57 | 20925432 | |
55 | Ubiquitination | AVIVTQKKVPDKLLD EEEEECCCCCHHHCC | 49.54 | 22790023 | |
59 | Acetylation | TQKKVPDKLLDSSTV ECCCCCHHHCCCCHH | 44.90 | 22826441 | |
63 | Phosphorylation | VPDKLLDSSTVTHLF CCHHHCCCCHHHHHH | 28.07 | 22817900 | |
64 | Phosphorylation | PDKLLDSSTVTHLFK CHHHCCCCHHHHHHH | 26.94 | 22817900 | |
65 | Phosphorylation | DKLLDSSTVTHLFKI HHHCCCCHHHHHHHH | 33.12 | 23984901 | |
73 | Phosphorylation | VTHLFKITESIGCVM HHHHHHHHHCCCCEE | 25.03 | 20469934 | |
75 | Phosphorylation | HLFKITESIGCVMTG HHHHHHHCCCCEECC | 18.68 | 20469934 | |
78 | S-nitrosylation | KITESIGCVMTGMTA HHHHCCCCEECCCCC | 1.48 | 21278135 | |
78 | S-nitrosocysteine | KITESIGCVMTGMTA HHHHCCCCEECCCCC | 1.48 | - | |
81 | Phosphorylation | ESIGCVMTGMTADSR HCCCCEECCCCCCCH | 11.91 | 20469934 | |
84 | Phosphorylation | GCVMTGMTADSRSQV CCEECCCCCCCHHHH | 28.76 | 20469934 | |
87 | Phosphorylation | MTGMTADSRSQVQRA ECCCCCCCHHHHHHH | 31.22 | 20469934 | |
89 | Phosphorylation | GMTADSRSQVQRARY CCCCCCHHHHHHHHH | 38.36 | 20469934 | |
96 | Phosphorylation | SQVQRARYEAANWKY HHHHHHHHHHHCCHH | 14.67 | 17242355 | |
102 | Ubiquitination | RYEAANWKYKYGYEI HHHHHCCHHHCCCCC | 31.50 | 22790023 | |
102 | Acetylation | RYEAANWKYKYGYEI HHHHHCCHHHCCCCC | 31.50 | 22826441 | |
103 | Phosphorylation | YEAANWKYKYGYEIP HHHHCCHHHCCCCCC | 10.89 | - | |
104 | Acetylation | EAANWKYKYGYEIPV HHHCCHHHCCCCCCH | 28.59 | 23806337 | |
104 | Malonylation | EAANWKYKYGYEIPV HHHCCHHHCCCCCCH | 28.59 | 26320211 | |
105 | Phosphorylation | AANWKYKYGYEIPVD HHCCHHHCCCCCCHH | 23.11 | 25195567 | |
107 | Phosphorylation | NWKYKYGYEIPVDML CCHHHCCCCCCHHHH | 13.95 | 25195567 | |
115 | Glutathionylation | EIPVDMLCKRIADIS CCCHHHHHHHHHHHH | 1.92 | 24333276 | |
116 | Acetylation | IPVDMLCKRIADISQ CCHHHHHHHHHHHHH | 42.76 | 22826441 | |
159 | Phosphorylation | YKCDPAGYYCGFKAT EEECCCCCCCCEEEE | 9.55 | 22817900 | |
160 | Phosphorylation | KCDPAGYYCGFKATA EECCCCCCCCEEEEE | 5.79 | 22817900 | |
164 | Acetylation | AGYYCGFKATAAGVK CCCCCCEEEEECCCC | 30.06 | 22826441 | |
171 | Acetylation | KATAAGVKQTESTSF EEEECCCCCCCCCCH | 51.05 | 22826441 | |
171 | Ubiquitination | KATAAGVKQTESTSF EEEECCCCCCCCCCH | 51.05 | 22790023 | |
173 | Phosphorylation | TAAGVKQTESTSFLE EECCCCCCCCCCHHH | 26.62 | 25338131 | |
175 | Phosphorylation | AGVKQTESTSFLEKK CCCCCCCCCCHHHHH | 32.51 | 28066266 | |
176 | Phosphorylation | GVKQTESTSFLEKKV CCCCCCCCCHHHHHH | 19.77 | 28066266 | |
177 | Phosphorylation | VKQTESTSFLEKKVK CCCCCCCCHHHHHHH | 36.79 | 25521595 | |
181 | Acetylation | ESTSFLEKKVKKKFD CCCCHHHHHHHHHCC | 66.08 | 23864654 | |
181 | Malonylation | ESTSFLEKKVKKKFD CCCCHHHHHHHHHCC | 66.08 | 26073543 | |
181 | Ubiquitination | ESTSFLEKKVKKKFD CCCCHHHHHHHHHCC | 66.08 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSA6_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSA6_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSA6_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PSA6_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-159, AND MASSSPECTROMETRY. |