PSA6_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA6_CAEEL
• UniProt AC: O17586
• Protein Name: Proteasome subunit alpha type-6
• Gene Name: pas-1
• Organism: Caenorhabditis elegans.
• Sequence Length: 246
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)..
• Protein Sequence: MSRGSSAGFDRHITIFSPEGRVYQVEYAFKAINSTNLTAVAVKGADAAVIAVQKRVPDSLIVADTVTSVYQISQSVGCCAIGMIPDAKFQIKRAQGEAASWKYKNGYDMPCELLAKKMADLNQYYTQNAEMRSLGCALLFISYDDEKGPEVYRVDPAGYYRGMKGVSVGVKQLPATSFLEKKIKKKSELTSTEAIELAIEALQTSLGIDVRSKDLEVVVVTKDNSKFTKLTSDQVEHHLNQIANRD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MSRGSSAGFDRH ---CCCCCCCCCCCE	18.86	19530675
6	Phosphorylation	--MSRGSSAGFDRHI --CCCCCCCCCCCEE	34.92	19530675
17	Phosphorylation	DRHITIFSPEGRVYQ CCEEEEECCCCCEEE	20.42	28854356

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA6_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA6_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA6_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSA3_CAEEL	pas-7	physical	14704431
PSA3_CAEEL	pas-7	physical	11559592
PSA3_CAEEL	pas-7	physical	18692475

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.