PSA6B_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA6B_ARATH
• UniProt AC: O81147
• Protein Name: Proteasome subunit alpha type-6-B
• Gene Name: PAA2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 246
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity..
• Protein Sequence: MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIADKSQVYTQHAYMRPLGVVAMVLGIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQTAISALQSVLQEDFKATEIEVGVVRADDPLFRSLRTEEIDEHLTAISERD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
47	Phosphorylation	IGVRGKDSVCVVTQK EEECCCCEEEEEECC	22.39	23111157
52	Phosphorylation	KDSVCVVTQKKVPDK CCEEEEEECCCCCHH	17.80	23111157
183	Sulfoxidation	VNFLEKKMKENPAFT HHHHHHHHHHCCCCC	11.03	23289948

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA6B_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA6B_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA6B_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PSB7A_ARATH	PBB1	physical	21798944
PSB7B_ARATH	PBB2	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.