PSA6A_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PSA6A_ARATH
• UniProt AC: O81146
• Protein Name: Proteasome subunit alpha type-6-A
• Gene Name: PAA1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 246
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity..
• Protein Sequence: MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLLDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADKSQVYTQHAYMRPLGVVAMVMGVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETVQTAISALQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	AVKTAGITSIGVRGK HHHHCCCEEEEECCC	17.24	24894044
39	Phosphorylation	VKTAGITSIGVRGKD HHHCCCEEEEECCCC	18.54	24894044
47	Phosphorylation	IGVRGKDSVCVVTQK EEECCCCEEEEEECC	22.39	23111157
52	Phosphorylation	KDSVCVVTQKKVPDK CCEEEEEECCCCCHH	17.80	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PSA6A_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PSA6A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PSA6A_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PSA6A_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.