dbPTM

PSA3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PSA3_ARATH
UniProt AC	O23715
Protein Name	Proteasome subunit alpha type-3
Gene Name	PAG1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	249
Subcellular Localization	Cytoplasm. Nucleus.
Protein Description	The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity..
Protein Sequence	MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHRHAGMAVAGLAADGRQIVARAKSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGKQAAKTEIEKLNLSEMTCKEGVIEVAKIIYKLHDEAKDKAFELEMSWICEESKREHQKVPDDLLEEAKTAAKTALEEMDAD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSSIGTGYD ------CCCCCCCCC	30.57	22223895
2	Phosphorylation	------MSSIGTGYD ------CCCCCCCCC	30.57	23328941
98	Phosphorylation	RAKSEARSYESVYGD HHHHHHHCHHHHHCC	40.06	26091701
99	Phosphorylation	AKSEARSYESVYGDA HHHHHHCHHHHHCCC	13.48	26091701
214	Acetylation	KAFELEMSWICEESK HHHHHHHHHHHHHHH	12.15	20516081
220	Acetylation	MSWICEESKREHQKV HHHHHHHHHHHHCCC	18.08	20516081
221	Ubiquitination	SWICEESKREHQKVP HHHHHHHHHHHCCCC	66.15	20516081
246	Sulfoxidation	AKTALEEMDAD---- HHHHHHHHCCC----	3.62	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PSA3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PSA3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PSA3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PSA3_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PSA3_ARATH

Related Literatures of Post-Translational Modification