UniProt ID | PRVA_MOUSE | |
---|---|---|
UniProt AC | P32848 | |
Protein Name | Parvalbumin alpha | |
Gene Name | Pvalb | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.. | |
Protein Sequence | MSMTDVLSAEDIKKAIGAFAAADSFDHKKFFQMVGLKKKNPDEVKKVFHILDKDKSGFIEEDELGSILKGFSSDARDLSAKETKTLLAAGDKDGDGKIGVEEFSTLVAES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSMTDVLSA ------CCHHHCCCH | 30.32 | 10036163 | |
2 | Phosphorylation | ------MSMTDVLSA ------CCHHHCCCH | 30.32 | 22210690 | |
4 | Phosphorylation | ----MSMTDVLSAED ----CCHHHCCCHHH | 18.69 | 22210690 | |
8 | Phosphorylation | MSMTDVLSAEDIKKA CCHHHCCCHHHHHHH | 29.47 | 22817900 | |
14 | Ubiquitination | LSAEDIKKAIGAFAA CCHHHHHHHHHHHHH | 45.64 | 22790023 | |
24 | Phosphorylation | GAFAAADSFDHKKFF HHHHHCCCCCHHHHH | 28.04 | 28464351 | |
28 | Ubiquitination | AADSFDHKKFFQMVG HCCCCCHHHHHHHHC | 53.79 | 22790023 | |
28 | Acetylation | AADSFDHKKFFQMVG HCCCCCHHHHHHHHC | 53.79 | 21728379 | |
29 | Acetylation | ADSFDHKKFFQMVGL CCCCCHHHHHHHHCC | 48.25 | 21728379 | |
29 | Ubiquitination | ADSFDHKKFFQMVGL CCCCCHHHHHHHHCC | 48.25 | 22790023 | |
37 | Acetylation | FFQMVGLKKKNPDEV HHHHHCCCCCCHHHH | 56.63 | 21728379 | |
37 | Ubiquitination | FFQMVGLKKKNPDEV HHHHHCCCCCCHHHH | 56.63 | 22790023 | |
39 | Ubiquitination | QMVGLKKKNPDEVKK HHHCCCCCCHHHHHH | 72.61 | - | |
46 | Ubiquitination | KNPDEVKKVFHILDK CCHHHHHHHHHHHCC | 56.14 | 22790023 | |
53 | Ubiquitination | KVFHILDKDKSGFIE HHHHHHCCCCCCCCC | 64.71 | 22790023 | |
53 | Acetylation | KVFHILDKDKSGFIE HHHHHHCCCCCCCCC | 64.71 | 21728379 | |
55 | Ubiquitination | FHILDKDKSGFIEED HHHHCCCCCCCCCHH | 59.21 | 22790023 | |
55 | Acetylation | FHILDKDKSGFIEED HHHHCCCCCCCCCHH | 59.21 | 21728379 | |
56 | Phosphorylation | HILDKDKSGFIEEDE HHHCCCCCCCCCHHH | 49.41 | 22210690 | |
66 | Phosphorylation | IEEDELGSILKGFSS CCHHHHHHHHHHCCC | 37.05 | 22210690 | |
69 | Ubiquitination | DELGSILKGFSSDAR HHHHHHHHHCCCCHH | 57.13 | 22790023 | |
69 | Acetylation | DELGSILKGFSSDAR HHHHHHHHHCCCCHH | 57.13 | 21728379 | |
72 | Phosphorylation | GSILKGFSSDARDLS HHHHHHCCCCHHHCC | 35.66 | 22817900 | |
73 | Phosphorylation | SILKGFSSDARDLSA HHHHHCCCCHHHCCH | 32.78 | 17203969 | |
79 | Phosphorylation | SSDARDLSAKETKTL CCCHHHCCHHHHHHH | 41.40 | 17203969 | |
81 | Ubiquitination | DARDLSAKETKTLLA CHHHCCHHHHHHHHH | 63.64 | 22790023 | |
83 | Phosphorylation | RDLSAKETKTLLAAG HHCCHHHHHHHHHCC | 28.73 | 17203969 | |
84 | Ubiquitination | DLSAKETKTLLAAGD HCCHHHHHHHHHCCC | 37.96 | 22790023 | |
85 | Phosphorylation | LSAKETKTLLAAGDK CCHHHHHHHHHCCCC | 34.13 | 22210690 | |
92 | Ubiquitination | TLLAAGDKDGDGKIG HHHHCCCCCCCCCCC | 63.79 | 22790023 | |
97 | Ubiquitination | GDKDGDGKIGVEEFS CCCCCCCCCCHHHHH | 40.81 | 22790023 | |
105 | Phosphorylation | IGVEEFSTLVAES-- CCHHHHHHHHCCC-- | 30.49 | - | |
110 | Phosphorylation | FSTLVAES------- HHHHHCCC------- | 35.47 | 22210690 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRVA_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRVA_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRVA_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRVA_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Electrospray ionization mass spectrometry: analysis of the Ca2+-binding properties of human recombinant alpha-parvalbumin and ninemutant proteins."; Troxler H., Kuster T., Rhyner J.A., Gehrig P., Heizmann C.W.; Anal. Biochem. 268:64-71(1999). Cited for: SEQUENCE REVISION TO 110, ACETYLATION AT SER-2, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-73; SER-79 AND THR-83,AND MASS SPECTROMETRY. |