| UniProt ID | PRVA_HUMAN | |
|---|---|---|
| UniProt AC | P20472 | |
| Protein Name | Parvalbumin alpha | |
| Gene Name | PVALB | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 110 | |
| Subcellular Localization | ||
| Protein Description | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.. | |
| Protein Sequence | MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSMTDLLNA ------CCHHHHCCH | 30.32 | 10036163 | |
| 2 | Phosphorylation | ------MSMTDLLNA ------CCHHHHCCH | 30.32 | 29255136 | |
| 4 | Phosphorylation | ----MSMTDLLNAED ----CCHHHHCCHHH | 19.05 | 29255136 | |
| 24 | Phosphorylation | GAFSATDSFDHKKFF CCCCCCCCCCHHHHH | 28.37 | - | |
| 72 | Phosphorylation | GFILKGFSPDARDLS HHHHCCCCCCHHHCC | 30.45 | 27251275 | |
| 83 | Phosphorylation | RDLSAKETKMLMAAG HHCCHHHHHHHHHCC | 22.50 | - | |
| 84 | Acetylation | DLSAKETKMLMAAGD HCCHHHHHHHHHCCC | 31.00 | 30591699 | |
| 97 | Acetylation | GDKDGDGKIGVDEFS CCCCCCCCCCHHCHH | 40.81 | 30591705 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRVA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRVA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRVA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PRVA_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Electrospray ionization mass spectrometry: analysis of the Ca2+-binding properties of human recombinant alpha-parvalbumin and ninemutant proteins."; Troxler H., Kuster T., Rhyner J.A., Gehrig P., Heizmann C.W.; Anal. Biochem. 268:64-71(1999). Cited for: MUTAGENESIS, ACETYLATION AT SER-2, AND MASS SPECTROMETRY. | |
