UniProt ID | PRVA_HUMAN | |
---|---|---|
UniProt AC | P20472 | |
Protein Name | Parvalbumin alpha | |
Gene Name | PVALB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 110 | |
Subcellular Localization | ||
Protein Description | In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions.. | |
Protein Sequence | MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSMTDLLNA ------CCHHHHCCH | 30.32 | 10036163 | |
2 | Phosphorylation | ------MSMTDLLNA ------CCHHHHCCH | 30.32 | 29255136 | |
4 | Phosphorylation | ----MSMTDLLNAED ----CCHHHHCCHHH | 19.05 | 29255136 | |
24 | Phosphorylation | GAFSATDSFDHKKFF CCCCCCCCCCHHHHH | 28.37 | - | |
72 | Phosphorylation | GFILKGFSPDARDLS HHHHCCCCCCHHHCC | 30.45 | 27251275 | |
83 | Phosphorylation | RDLSAKETKMLMAAG HHCCHHHHHHHHHCC | 22.50 | - | |
84 | Acetylation | DLSAKETKMLMAAGD HCCHHHHHHHHHCCC | 31.00 | 30591699 | |
97 | Acetylation | GDKDGDGKIGVDEFS CCCCCCCCCCHHCHH | 40.81 | 30591705 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRVA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRVA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRVA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRVA_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Electrospray ionization mass spectrometry: analysis of the Ca2+-binding properties of human recombinant alpha-parvalbumin and ninemutant proteins."; Troxler H., Kuster T., Rhyner J.A., Gehrig P., Heizmann C.W.; Anal. Biochem. 268:64-71(1999). Cited for: MUTAGENESIS, ACETYLATION AT SER-2, AND MASS SPECTROMETRY. |