UniProt ID | PRTN3_HUMAN | |
---|---|---|
UniProt AC | P24158 | |
Protein Name | Myeloblastin | |
Gene Name | PRTN3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 256 | |
Subcellular Localization |
Cytoplasmic granule . Secreted . Cell membrane Peripheral membrane protein Extracellular side . Membrane raft Peripheral membrane protein Extracellular side . Localizes predominantly to azurophil granules (primary secretory granules) in neutr |
|
Protein Description | Serine protease that degrades elastin, fibronectin, laminin, vitronectin, and collagen types I, III, and IV (in vitro). [PubMed: 3198760] | |
Protein Sequence | MAHRPPSPALASVLLALLLSGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTLIHPSFVLTAAHCLRDIPQRLVNVVLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKLNDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAMGWGRVGAHDPPAQVLQELNVTVVTFFCRPHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTRVALYVDWIRSTLRRVEAKGRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
129 | N-linked_Glycosylation | IQLSSPANLSASVAT EEECCCCCCEEEEEE | 37.60 | UniProtKB CARBOHYD | |
174 | N-linked_Glycosylation | AQVLQELNVTVVTFF HHHHHHCCEEEEEEE | 27.02 | 8757293 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRTN3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRTN3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRTN3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ITAM_HUMAN | ITGAM | physical | 12960243 | |
A1AT_HUMAN | SERPINA1 | physical | 12114510 | |
ILEU_HUMAN | SERPINB1 | physical | 12114510 | |
ELN_HUMAN | ELN | physical | 11867344 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...