PRS46_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PRS46_HUMAN
• UniProt AC: E5RG02
• Protein Name: Putative serine protease 46
• Gene Name: PRSS46P {ECO:0000312|HGNC:HGNC:37325}
• Organism: Homo sapiens (Human).
• Sequence Length: 174
• Protein Sequence: MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	CGPGDLQSLTSPLSS CCCCCHHHCCCCCHH	40.69	29449344
12	Phosphorylation	PGDLQSLTSPLSSAR CCCHHHCCCCCHHCC	33.28	29449344
13	Phosphorylation	GDLQSLTSPLSSARL CCHHHCCCCCHHCCC	29.18	29449344
16	Phosphorylation	QSLTSPLSSARLDYQ HHCCCCCHHCCCCCC	25.90	29449344
17	Phosphorylation	SLTSPLSSARLDYQP HCCCCCHHCCCCCCC	25.70	29449344
37	Phosphorylation	WLRACGQTNVSCRVV HHHHCCCCCCEEEEE	23.91	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PRS46_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PRS46_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PRS46_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of PRS46_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.