UniProt ID | PRS46_HUMAN | |
---|---|---|
UniProt AC | E5RG02 | |
Protein Name | Putative serine protease 46 | |
Gene Name | PRSS46P {ECO:0000312|HGNC:HGNC:37325} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 174 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MACGPGDLQSLTSPLSSARLDYQPSIEGPWLRACGQTNVSCRVVKGKLVEVGKWPWQVSILFLGTYICSGSLIHHQWVLTAAHCLQRFKDLSLYSVMVGVHQRPENSTQLPLTRMVIHKDFSNLMSQDIALLKLRDSISWSPFVQPVCLPNIKFKPSIGSMCWVIGWGTTGKKG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | CGPGDLQSLTSPLSS CCCCCHHHCCCCCHH | 40.69 | 29449344 | |
12 | Phosphorylation | PGDLQSLTSPLSSAR CCCHHHCCCCCHHCC | 33.28 | 29449344 | |
13 | Phosphorylation | GDLQSLTSPLSSARL CCHHHCCCCCHHCCC | 29.18 | 29449344 | |
16 | Phosphorylation | QSLTSPLSSARLDYQ HHCCCCCHHCCCCCC | 25.90 | 29449344 | |
17 | Phosphorylation | SLTSPLSSARLDYQP HCCCCCHHCCCCCCC | 25.70 | 29449344 | |
37 | Phosphorylation | WLRACGQTNVSCRVV HHHHCCCCCCEEEEE | 23.91 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRS46_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRS46_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRS46_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRS46_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...