dbPTM

PRR7_RAT - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PRR7_RAT
UniProt AC	P0C6T3
Protein Name	Proline-rich protein 7
Gene Name	Prr7
Organism	Rattus norvegicus (Rat).
Sequence Length	269
Subcellular Localization	Cell membrane Single-pass type III membrane protein . Cell junction, synapse, postsynaptic cell membrane Single-pass type III membrane protein . Cytoplasm, perinuclear region . Cell junction, synapse . Cell projection, dendrite . Nucleus . Enrich
Protein Description	Acts as a synapse-to-nucleus messenger to promote NMDA receptor-mediated excitotoxicity in neurons in a JUN-dependent manner. [PubMed: 27458189 Inhibits ubiquitination-mediated degradation and promotes phosphorylation and transcriptional activity of transcription factor JUN]
Protein Sequence	MVMSQGTYTFLTCFAGFWLIWGLIVLLCCFCSFLRRRLKRRQEERLREQNLRALELEPLELEGSLAGSPPGLAPPPPPHRSRLEAPVHAHSHVHVHPLLHHGPAQPHAHPHPHHHALPHPPPSHLSVPPRPWSYPRQAESDMSKPPCYEEAVLMAEPPPPYSEVLTDTRGLYRKIVTPFLSRRDSAEKQEQPPPSYKPLFLDRGYTSALHLPSAPRPAAPCPALCLQADRSRRVFPSWTDSELSSREPLEHGAWRLPVSIPLFGRTTAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	Phosphorylation	EPLELEGSLAGSPPG CCEEEECCCCCCCCC	12.98	28551015
68	Phosphorylation	LEGSLAGSPPGLAPP EECCCCCCCCCCCCC	23.47	28551015
185	Phosphorylation	PFLSRRDSAEKQEQP HHHHCCCCHHHCCCC	36.19	25403869
197	Ubiquitination	EQPPPSYKPLFLDRG CCCCCCCCCCEECCC	39.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PRR7_RAT !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PRR7_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PRR7_RAT !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PRR7_RAT !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PRR7_RAT

Related Literatures of Post-Translational Modification