| UniProt ID | PRR35_HUMAN | |
|---|---|---|
| UniProt AC | P0CG20 | |
| Protein Name | Proline-rich protein 35 | |
| Gene Name | PRR35 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 571 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSREAGSCRVGTGARARSRKPKKPHYIPRPWGKPYNYKCFQCPFTCLEKSHLYNHMKYSLCKDSLSLLLDSPDWACRRGSTTPRPHAPTPDRPGESDPGRQPQGARPTGAAPAPDLVVADIHSLHCGGGPKSRAKGSPGPPPPVARATRKGPGPSGLLPESWKPGMGGDPRGVGAGDMASAGPEGSVPCYPPPAPGEFPEAHSLHLSLLGVNYPLSPGLFSYLGPSLAAAAHVPFLASASPLLPPATAFPAVQPPQRPTPAPRLYYPLLLEHTLGLPAGKAALAKAPVSPRSPSGTPAPGLLKVPVPGLGPWPRVTPRDPGQEGELERAAQSDPRRRLSLGSRLELPKASPSLTRFCSRSSLPTGSSVMLWPEDGDPGGPETPGPEGPLPLQPRGPVPGSPEHVGEDLTRALGDYARVEQRLGQLGPAGGLAPRPLREQLGKIRLELLTIHQALEQAVRPPDAPLDLSVKRAPAKGPQALGEAWGRPELGPVLTGGTPEPPGMLGPAAPQPFSGHTTKCEADSSVPPPGLPLAAPDDPVIPGSGWGTCVATRSSQTPEAVCGLQSPQGAEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 37 | Phosphorylation | PWGKPYNYKCFQCPF CCCCCCCCCEEECCC | 19658100 | ||
| 82 | Phosphorylation | ACRRGSTTPRPHAPT HHHCCCCCCCCCCCC | 32645325 | ||
| 137 | Phosphorylation | PKSRAKGSPGPPPPV HHHHCCCCCCCCCCC | 28634298 | ||
| 292 | Phosphorylation | KAPVSPRSPSGTPAP CCCCCCCCCCCCCCC | 27251275 | ||
| 332 | Phosphorylation | ELERAAQSDPRRRLS HHHHHHHCCCCHHCC | 24732914 | ||
| 342 | Phosphorylation | RRRLSLGSRLELPKA CHHCCCHHCCCCCCC | 28348404 | ||
| 350 | Phosphorylation | RLELPKASPSLTRFC CCCCCCCCHHHHHHH | 27282143 | ||
| 352 | Phosphorylation | ELPKASPSLTRFCSR CCCCCCHHHHHHHCC | - | ||
| 354 | Phosphorylation | PKASPSLTRFCSRSS CCCCHHHHHHHCCCC | - | ||
| 358 | Phosphorylation | PSLTRFCSRSSLPTG HHHHHHHCCCCCCCC | 24719451 | ||
| 409 | Phosphorylation | EHVGEDLTRALGDYA HHHHHHHHHHHHHHH | 22210691 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRR35_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRR35_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRR35_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PRR35_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...