UniProt ID | PRR19_HUMAN | |
---|---|---|
UniProt AC | A6NJB7 | |
Protein Name | Proline-rich protein 19 | |
Gene Name | PRR19 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 356 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIRDPPVVPTASKLVVITQGRLSREHRGLFNHEVKSLDVARLLSSGTLVPGSPTLPAKPSPSPGRAQEPAPRSRDKENQVPGGSGPGPPSSPELSGVGQLLAELQCQLSLPQAFPRRNLIQDARDAIVHTLQACHGCVPDLALVLRGCQPPLPGAKPGVSERKMTPFWINSPDQVPEQERQRKQQGTKEFTFPMPYTSSMPTAHRGSLAPPRGPWPPYFPSLSSPSGTAWGPPTAFDLLKSIWLVATPPPPRPWGVGLPQPLPQPSSPLLPRTSVLDWSPSPPSPLPSLSWVVAQSSPEAWSFPPMRLY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
107 | Phosphorylation | PTLPAKPSPSPGRAQ CCCCCCCCCCCCCCC | 36.98 | 24719451 | |
109 | Phosphorylation | LPAKPSPSPGRAQEP CCCCCCCCCCCCCCC | 44.30 | 30266825 | |
243 | Phosphorylation | EFTFPMPYTSSMPTA EEECCCCCCCCCCCC | 17.01 | 30576142 | |
244 | Phosphorylation | FTFPMPYTSSMPTAH EECCCCCCCCCCCCC | 14.41 | - | |
245 | Phosphorylation | TFPMPYTSSMPTAHR ECCCCCCCCCCCCCC | 20.85 | 30576142 | |
246 | Phosphorylation | FPMPYTSSMPTAHRG CCCCCCCCCCCCCCC | 22.45 | - | |
254 | Phosphorylation | MPTAHRGSLAPPRGP CCCCCCCCCCCCCCC | 22.70 | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRR19_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRR19_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRR19_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PRR19_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...